Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LYX1

Protein Details
Accession B8LYX1    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-51IPLYRRLLRVHRKKLPPQMRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRVLTRLLAAPTTIGSKASLTTEPLALLPPIPLYRRLLRVHRKKLPPQMRLLGDEYVKSEFRAHRNVDNPIHIVGFLTEWQLYAQQLEGDSWQGGKLDKAKLDKMSDQQIGQLYELMQAIQNKSEGDGERE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.12
5 0.14
6 0.14
7 0.14
8 0.15
9 0.15
10 0.15
11 0.14
12 0.14
13 0.12
14 0.11
15 0.09
16 0.09
17 0.11
18 0.12
19 0.14
20 0.18
21 0.21
22 0.28
23 0.32
24 0.4
25 0.48
26 0.57
27 0.65
28 0.7
29 0.74
30 0.76
31 0.82
32 0.82
33 0.76
34 0.72
35 0.69
36 0.62
37 0.56
38 0.51
39 0.42
40 0.33
41 0.28
42 0.23
43 0.18
44 0.16
45 0.14
46 0.15
47 0.16
48 0.19
49 0.24
50 0.25
51 0.28
52 0.31
53 0.35
54 0.34
55 0.32
56 0.29
57 0.24
58 0.22
59 0.17
60 0.14
61 0.09
62 0.08
63 0.06
64 0.06
65 0.05
66 0.06
67 0.06
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.1
83 0.14
84 0.16
85 0.2
86 0.24
87 0.28
88 0.31
89 0.35
90 0.37
91 0.38
92 0.42
93 0.4
94 0.37
95 0.36
96 0.36
97 0.32
98 0.28
99 0.25
100 0.18
101 0.17
102 0.17
103 0.14
104 0.13
105 0.15
106 0.16
107 0.16
108 0.17
109 0.16
110 0.17
111 0.22