Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H9CNM4

Protein Details
Accession H9CNM4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-63GHIWIQKPSDKKRHNPRFCITFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 2.5, cyto_mito 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027434  Homing_endonucl  
IPR004860  LAGLIDADG_2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF00961  LAGLIDADG_1  
Amino Acid Sequences MAKKEDLRGSNIRYYSNNLKYSDINKDSKIKGYLAGLFEGNGHIWIQKPSDKKRHNPRFCITFSIKNEPLAKKLLELIGSGFIRYKLQDNACVLVVSPVIGLKKIVDLLNGELRTPKIHQLHSLIDWLNKNHNTNITKLPLKDNPLSEDGWLSGFIDSDGSFSVQYTKLEDGAKKRKISCRLRIEQRMFDPISNESYFKVLTDISNFLNCSLLIRKQKSTGNEYYNLTASSKLSLNLIVNYLEKYPLFSSKYLDYKDWKKIVLLILENKHYTEQGINETEYVRNGMNRKRTYFNWDHLNLLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.51
4 0.51
5 0.45
6 0.46
7 0.48
8 0.5
9 0.53
10 0.5
11 0.46
12 0.45
13 0.51
14 0.5
15 0.52
16 0.5
17 0.41
18 0.37
19 0.36
20 0.37
21 0.31
22 0.3
23 0.24
24 0.21
25 0.2
26 0.18
27 0.15
28 0.11
29 0.09
30 0.08
31 0.1
32 0.12
33 0.15
34 0.19
35 0.27
36 0.36
37 0.47
38 0.54
39 0.62
40 0.72
41 0.8
42 0.84
43 0.85
44 0.83
45 0.8
46 0.74
47 0.72
48 0.66
49 0.64
50 0.59
51 0.59
52 0.53
53 0.5
54 0.55
55 0.48
56 0.46
57 0.41
58 0.36
59 0.28
60 0.29
61 0.25
62 0.19
63 0.18
64 0.16
65 0.17
66 0.17
67 0.16
68 0.15
69 0.14
70 0.14
71 0.14
72 0.16
73 0.17
74 0.19
75 0.24
76 0.24
77 0.25
78 0.25
79 0.24
80 0.21
81 0.16
82 0.14
83 0.09
84 0.07
85 0.07
86 0.06
87 0.07
88 0.07
89 0.06
90 0.07
91 0.09
92 0.09
93 0.09
94 0.09
95 0.12
96 0.18
97 0.18
98 0.17
99 0.16
100 0.16
101 0.17
102 0.18
103 0.22
104 0.2
105 0.21
106 0.24
107 0.26
108 0.28
109 0.28
110 0.29
111 0.23
112 0.22
113 0.23
114 0.21
115 0.24
116 0.24
117 0.24
118 0.22
119 0.28
120 0.26
121 0.28
122 0.31
123 0.29
124 0.29
125 0.29
126 0.32
127 0.28
128 0.32
129 0.32
130 0.29
131 0.28
132 0.27
133 0.26
134 0.22
135 0.19
136 0.14
137 0.12
138 0.1
139 0.08
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.07
151 0.08
152 0.08
153 0.1
154 0.1
155 0.12
156 0.14
157 0.17
158 0.23
159 0.31
160 0.37
161 0.39
162 0.43
163 0.47
164 0.55
165 0.62
166 0.63
167 0.64
168 0.67
169 0.73
170 0.78
171 0.75
172 0.7
173 0.64
174 0.6
175 0.51
176 0.42
177 0.35
178 0.27
179 0.27
180 0.22
181 0.21
182 0.15
183 0.15
184 0.15
185 0.13
186 0.12
187 0.08
188 0.08
189 0.1
190 0.12
191 0.12
192 0.14
193 0.14
194 0.13
195 0.13
196 0.12
197 0.12
198 0.13
199 0.19
200 0.25
201 0.29
202 0.31
203 0.35
204 0.39
205 0.42
206 0.46
207 0.47
208 0.44
209 0.44
210 0.45
211 0.42
212 0.39
213 0.35
214 0.28
215 0.22
216 0.17
217 0.15
218 0.14
219 0.13
220 0.12
221 0.13
222 0.14
223 0.14
224 0.15
225 0.13
226 0.13
227 0.14
228 0.14
229 0.14
230 0.12
231 0.14
232 0.15
233 0.19
234 0.21
235 0.21
236 0.24
237 0.28
238 0.35
239 0.35
240 0.37
241 0.39
242 0.43
243 0.51
244 0.51
245 0.46
246 0.4
247 0.42
248 0.43
249 0.41
250 0.39
251 0.38
252 0.39
253 0.43
254 0.42
255 0.39
256 0.36
257 0.3
258 0.26
259 0.21
260 0.19
261 0.21
262 0.24
263 0.23
264 0.23
265 0.25
266 0.24
267 0.22
268 0.21
269 0.17
270 0.19
271 0.25
272 0.31
273 0.4
274 0.45
275 0.49
276 0.53
277 0.55
278 0.6
279 0.61
280 0.61
281 0.61
282 0.56
283 0.54