Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A7U8

Protein Details
Accession A0A2H1A7U8    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-131NSLYRNCRPETQRKKLRKKKENSHNDQTGYHydrophilic
200-219AEESGKRRRERRFKAFPYTGBasic
NLS Segment(s)
PositionSequence
114-121RKKLRKKK
205-211KRRRERR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006571  TLDc_dom  
Pfam View protein in Pfam  
PF07534  TLD  
PROSITE View protein in PROSITE  
PS51886  TLDC  
Amino Acid Sequences MSIDVSDTTPVNKQPKKQPSLLGRLLRNNNRSPSPESDQSSTPESLPPLADLQLSGYAPGTKHRVLDEELASNIRNLLPPRLQLYNEWELLYSLEQHGISLNSLYRNCRPETQRKKLRKKKENSHNDQTGYAEGVIKNMVAFGDPSRNKGSRPHGYVLVVQDEHKNKFGCYMSEHPHPSEHKRYYGNGECFLWKCEWYHAEESGKRRRERRFKAFPYTGLNDNLVYSNVDFIAVGSSHGQNGLYIDKSLYSGVSYPCETFGNEILCEHVPGEKYGSFKIINLEVWRVGELDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.67
4 0.69
5 0.71
6 0.71
7 0.75
8 0.76
9 0.73
10 0.69
11 0.71
12 0.75
13 0.74
14 0.72
15 0.69
16 0.66
17 0.63
18 0.62
19 0.59
20 0.56
21 0.55
22 0.56
23 0.53
24 0.51
25 0.48
26 0.47
27 0.45
28 0.39
29 0.32
30 0.27
31 0.24
32 0.22
33 0.2
34 0.18
35 0.15
36 0.15
37 0.14
38 0.12
39 0.12
40 0.13
41 0.13
42 0.11
43 0.11
44 0.11
45 0.12
46 0.15
47 0.19
48 0.17
49 0.19
50 0.2
51 0.22
52 0.23
53 0.28
54 0.26
55 0.23
56 0.23
57 0.23
58 0.22
59 0.19
60 0.17
61 0.13
62 0.14
63 0.13
64 0.17
65 0.18
66 0.2
67 0.23
68 0.25
69 0.26
70 0.24
71 0.3
72 0.3
73 0.28
74 0.26
75 0.23
76 0.2
77 0.2
78 0.18
79 0.13
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.16
92 0.19
93 0.22
94 0.24
95 0.3
96 0.34
97 0.42
98 0.52
99 0.59
100 0.65
101 0.72
102 0.82
103 0.85
104 0.9
105 0.89
106 0.89
107 0.89
108 0.9
109 0.9
110 0.88
111 0.87
112 0.82
113 0.73
114 0.63
115 0.53
116 0.42
117 0.32
118 0.23
119 0.15
120 0.1
121 0.09
122 0.08
123 0.07
124 0.06
125 0.05
126 0.05
127 0.03
128 0.04
129 0.04
130 0.13
131 0.13
132 0.16
133 0.2
134 0.21
135 0.22
136 0.28
137 0.35
138 0.33
139 0.38
140 0.37
141 0.35
142 0.36
143 0.37
144 0.32
145 0.27
146 0.2
147 0.17
148 0.19
149 0.2
150 0.21
151 0.22
152 0.21
153 0.18
154 0.22
155 0.23
156 0.19
157 0.21
158 0.25
159 0.26
160 0.32
161 0.34
162 0.31
163 0.34
164 0.36
165 0.38
166 0.42
167 0.4
168 0.38
169 0.39
170 0.4
171 0.44
172 0.49
173 0.46
174 0.39
175 0.37
176 0.35
177 0.34
178 0.34
179 0.27
180 0.19
181 0.17
182 0.18
183 0.19
184 0.2
185 0.22
186 0.24
187 0.28
188 0.32
189 0.38
190 0.44
191 0.5
192 0.5
193 0.55
194 0.62
195 0.67
196 0.72
197 0.76
198 0.78
199 0.77
200 0.82
201 0.79
202 0.73
203 0.69
204 0.62
205 0.55
206 0.46
207 0.4
208 0.3
209 0.27
210 0.24
211 0.17
212 0.14
213 0.11
214 0.1
215 0.08
216 0.08
217 0.07
218 0.07
219 0.08
220 0.07
221 0.08
222 0.09
223 0.1
224 0.1
225 0.11
226 0.1
227 0.09
228 0.1
229 0.12
230 0.11
231 0.11
232 0.11
233 0.11
234 0.12
235 0.12
236 0.11
237 0.09
238 0.11
239 0.13
240 0.16
241 0.17
242 0.17
243 0.18
244 0.19
245 0.18
246 0.18
247 0.2
248 0.2
249 0.19
250 0.18
251 0.2
252 0.19
253 0.19
254 0.17
255 0.16
256 0.14
257 0.15
258 0.19
259 0.18
260 0.2
261 0.21
262 0.25
263 0.22
264 0.22
265 0.25
266 0.24
267 0.26
268 0.27
269 0.29
270 0.26
271 0.27
272 0.26
273 0.22