Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A218

Protein Details
Accession A0A2H1A218   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRKAAAKPQKKIKQKLDTTFRCLFHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKAAAKPQKKIK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAAKPQKKIKQKLDTTFRCLFCNHEKSVICTLDKKNGVGDLACKICGQSFQTAINSLSQPVDIYSDWIDACEDLAEEAEARGADLENVEEAYSDDDDDAPSRSARDRGLSDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.87
4 0.87
5 0.86
6 0.83
7 0.8
8 0.78
9 0.69
10 0.6
11 0.51
12 0.47
13 0.45
14 0.45
15 0.39
16 0.38
17 0.37
18 0.4
19 0.46
20 0.43
21 0.35
22 0.35
23 0.35
24 0.36
25 0.37
26 0.33
27 0.27
28 0.25
29 0.25
30 0.19
31 0.18
32 0.14
33 0.14
34 0.14
35 0.13
36 0.12
37 0.11
38 0.12
39 0.13
40 0.11
41 0.11
42 0.12
43 0.13
44 0.14
45 0.14
46 0.14
47 0.13
48 0.11
49 0.1
50 0.08
51 0.08
52 0.07
53 0.08
54 0.06
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.07
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.05
81 0.05
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.1
90 0.12
91 0.11
92 0.11
93 0.13
94 0.15
95 0.18
96 0.2
97 0.25
98 0.25
99 0.3