Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZNY7

Protein Details
Accession A0A2H0ZNY7   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-67FDEKKDYMRRCNKKHAAQQKSPPCPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 12.833, nucl 10.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MPFLSKKKSSSSTHSSASDSSSILSSLTGNNNNNKKKCFTKFDEKKDYMRRCNKKHAAQQKSPPCPVTFCLGKKSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.41
4 0.38
5 0.31
6 0.23
7 0.18
8 0.14
9 0.12
10 0.1
11 0.09
12 0.07
13 0.08
14 0.12
15 0.16
16 0.17
17 0.24
18 0.33
19 0.39
20 0.42
21 0.42
22 0.42
23 0.45
24 0.48
25 0.48
26 0.47
27 0.51
28 0.58
29 0.65
30 0.72
31 0.68
32 0.7
33 0.73
34 0.74
35 0.73
36 0.74
37 0.74
38 0.71
39 0.79
40 0.8
41 0.79
42 0.81
43 0.82
44 0.81
45 0.79
46 0.83
47 0.83
48 0.81
49 0.77
50 0.7
51 0.61
52 0.54
53 0.48
54 0.45
55 0.42
56 0.37