Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZIF2

Protein Details
Accession A0A2H0ZIF2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
309-355EIEKREIERERNTRRLKRENMRREVDDLSGTKRRAITRRRDENDWRFBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0016586  C:RSC-type complex  
GO:0031055  P:chromatin remodeling at centromere  
GO:0007059  P:chromosome segregation  
GO:0006302  P:double-strand break repair  
GO:0000086  P:G2/M transition of mitotic cell cycle  
GO:0006337  P:nucleosome disassembly  
GO:0033262  P:regulation of nuclear cell cycle DNA replication  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MSLTYQGNPYDPQALSSGLFSRVTKDPDSAIIVNSIPQERSAKRNAQQINYAEFDNINDDFEYDEERNGSNNTIPSASTHVVSSVPKHLLKAAKLTKPISACDKEQAIAKTGEQLLVPIKLNIEYNSGTSKLVDFFMWSVDESLVSPEQFASILTSDLELPTHVNQDIVDAITKQIEEYQSILTCPLPAGQDYFVIIELSVNLDKKLYEDKFEWDLQQTELSPEDFAETVVGDLGLSLEFKPAIAHSLHETILRIKREILEGTYNNELIKYQQLSGLIFESSIRIRTDSSLHNGNAVWEPFIEILSPWEIEKREIERERNTRRLKRENMRREVDDLSGTKRRAITRRRDENDWRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.21
4 0.21
5 0.17
6 0.2
7 0.18
8 0.21
9 0.25
10 0.29
11 0.28
12 0.28
13 0.27
14 0.28
15 0.33
16 0.29
17 0.25
18 0.23
19 0.21
20 0.21
21 0.23
22 0.22
23 0.17
24 0.18
25 0.24
26 0.25
27 0.31
28 0.36
29 0.42
30 0.45
31 0.53
32 0.57
33 0.55
34 0.6
35 0.58
36 0.55
37 0.48
38 0.43
39 0.35
40 0.29
41 0.25
42 0.21
43 0.17
44 0.14
45 0.12
46 0.11
47 0.11
48 0.11
49 0.16
50 0.13
51 0.13
52 0.13
53 0.14
54 0.15
55 0.16
56 0.17
57 0.15
58 0.16
59 0.16
60 0.16
61 0.15
62 0.15
63 0.2
64 0.19
65 0.17
66 0.16
67 0.15
68 0.16
69 0.17
70 0.18
71 0.18
72 0.21
73 0.21
74 0.22
75 0.26
76 0.28
77 0.29
78 0.36
79 0.39
80 0.39
81 0.44
82 0.44
83 0.44
84 0.41
85 0.42
86 0.4
87 0.36
88 0.32
89 0.31
90 0.31
91 0.28
92 0.31
93 0.3
94 0.25
95 0.23
96 0.21
97 0.21
98 0.21
99 0.2
100 0.15
101 0.15
102 0.14
103 0.15
104 0.15
105 0.11
106 0.11
107 0.11
108 0.13
109 0.12
110 0.14
111 0.12
112 0.13
113 0.14
114 0.14
115 0.14
116 0.13
117 0.13
118 0.11
119 0.11
120 0.1
121 0.08
122 0.08
123 0.08
124 0.09
125 0.08
126 0.08
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.07
134 0.06
135 0.07
136 0.06
137 0.06
138 0.06
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.05
147 0.06
148 0.06
149 0.08
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.07
156 0.07
157 0.05
158 0.05
159 0.06
160 0.06
161 0.05
162 0.06
163 0.07
164 0.07
165 0.08
166 0.09
167 0.09
168 0.09
169 0.1
170 0.08
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.08
177 0.08
178 0.08
179 0.08
180 0.08
181 0.07
182 0.07
183 0.06
184 0.05
185 0.04
186 0.06
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.08
193 0.16
194 0.14
195 0.16
196 0.17
197 0.21
198 0.25
199 0.26
200 0.26
201 0.2
202 0.21
203 0.18
204 0.18
205 0.15
206 0.12
207 0.12
208 0.11
209 0.09
210 0.08
211 0.09
212 0.08
213 0.07
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.03
220 0.03
221 0.03
222 0.03
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.08
231 0.07
232 0.08
233 0.11
234 0.13
235 0.14
236 0.14
237 0.15
238 0.19
239 0.24
240 0.25
241 0.23
242 0.22
243 0.23
244 0.25
245 0.26
246 0.23
247 0.24
248 0.24
249 0.26
250 0.27
251 0.26
252 0.23
253 0.22
254 0.19
255 0.13
256 0.17
257 0.15
258 0.14
259 0.15
260 0.17
261 0.17
262 0.18
263 0.18
264 0.12
265 0.11
266 0.1
267 0.11
268 0.1
269 0.13
270 0.12
271 0.12
272 0.13
273 0.15
274 0.19
275 0.21
276 0.25
277 0.29
278 0.28
279 0.29
280 0.28
281 0.29
282 0.29
283 0.25
284 0.21
285 0.14
286 0.16
287 0.14
288 0.14
289 0.12
290 0.08
291 0.09
292 0.11
293 0.11
294 0.1
295 0.14
296 0.15
297 0.17
298 0.22
299 0.24
300 0.32
301 0.38
302 0.45
303 0.51
304 0.6
305 0.67
306 0.72
307 0.78
308 0.77
309 0.8
310 0.84
311 0.84
312 0.85
313 0.87
314 0.88
315 0.87
316 0.86
317 0.8
318 0.73
319 0.66
320 0.57
321 0.52
322 0.43
323 0.41
324 0.4
325 0.38
326 0.38
327 0.4
328 0.45
329 0.49
330 0.56
331 0.6
332 0.64
333 0.75
334 0.77
335 0.81