Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H0ZLW7

Protein Details
Accession A0A2H0ZLW7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRTHKWNTHKKDAVPRYFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
Amino Acid Sequences MTRTHKWNTHKKDAVPRYFSRSGGHTDMNPSKVARSGFGKHNWGQPGDELDDEEGFEDQTFFSKSNRRNSNHAINEQALKELNEKCDKLVTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.76
3 0.7
4 0.68
5 0.65
6 0.59
7 0.5
8 0.42
9 0.39
10 0.35
11 0.34
12 0.26
13 0.3
14 0.32
15 0.32
16 0.3
17 0.25
18 0.22
19 0.23
20 0.23
21 0.18
22 0.19
23 0.21
24 0.25
25 0.29
26 0.33
27 0.31
28 0.36
29 0.35
30 0.32
31 0.28
32 0.23
33 0.22
34 0.18
35 0.16
36 0.11
37 0.1
38 0.09
39 0.08
40 0.08
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.06
47 0.07
48 0.07
49 0.1
50 0.17
51 0.23
52 0.33
53 0.42
54 0.44
55 0.51
56 0.57
57 0.65
58 0.65
59 0.63
60 0.57
61 0.51
62 0.51
63 0.44
64 0.38
65 0.29
66 0.23
67 0.25
68 0.24
69 0.29
70 0.32
71 0.32
72 0.32
73 0.36