Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H1A742

Protein Details
Accession A0A2H1A742   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-100INTSRKWVLPPRPRPGRKPTTSHydrophilic
102-125SSPGSEKAMQKRKPKVKREEAAAVHydrophilic
NLS Segment(s)
PositionSequence
88-119PPRPRPGRKPTTSGSSPGSEKAMQKRKPKVKR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR018287  Hap4_TF_heteromerisation  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10297  Hap4_Hap_bind  
Amino Acid Sequences MQTSTSLRASTSMQVQTSMSSENSQNENSNAQPATTKYAKIQPAIAIKPKPSVIPKSTFNPAYNQQAKTSSAPQTDSLINTSRKWVLPPRPRPGRKPTTSGSSPGSEKAMQKRKPKVKREEAAAVTSAPSTAVIDSCGSPAQSKRRISTASGVAVAVTGVSNGSPQTSVNSSRKGSASASVTPAPSISTAASSPRNYSASTAQFPTSHDRVNDLQKSYLARIKEQELIRNYIDVLTKQIKQLRFVQSGVITFDVLNDTSIIETSRPAKQQASSFESLDHINNIHDLDKHLAYVTTQSNVLHSVTKKYNGVNNVGMGRPLSDDQTSRSVSRQVRTILDRRHPKDDVSSSVERSESFTPSLLQPLRMNTLDPEENLVVDIVNSGDSLGGERNRVDDSMPEPSIEIMNLLQDSETKPALDKKPRKIGCGFCTNDTPCVCFDADTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.26
5 0.25
6 0.19
7 0.18
8 0.2
9 0.23
10 0.27
11 0.28
12 0.29
13 0.28
14 0.31
15 0.28
16 0.31
17 0.26
18 0.23
19 0.24
20 0.23
21 0.28
22 0.28
23 0.28
24 0.27
25 0.35
26 0.39
27 0.38
28 0.39
29 0.38
30 0.43
31 0.47
32 0.5
33 0.46
34 0.44
35 0.47
36 0.45
37 0.44
38 0.43
39 0.46
40 0.44
41 0.46
42 0.49
43 0.49
44 0.56
45 0.55
46 0.49
47 0.47
48 0.46
49 0.5
50 0.52
51 0.49
52 0.44
53 0.43
54 0.44
55 0.42
56 0.43
57 0.39
58 0.35
59 0.36
60 0.34
61 0.34
62 0.33
63 0.31
64 0.28
65 0.28
66 0.28
67 0.26
68 0.29
69 0.3
70 0.28
71 0.32
72 0.38
73 0.42
74 0.5
75 0.59
76 0.65
77 0.72
78 0.78
79 0.81
80 0.83
81 0.83
82 0.77
83 0.74
84 0.68
85 0.66
86 0.62
87 0.58
88 0.51
89 0.44
90 0.4
91 0.35
92 0.34
93 0.29
94 0.31
95 0.37
96 0.44
97 0.47
98 0.55
99 0.64
100 0.71
101 0.78
102 0.83
103 0.84
104 0.84
105 0.83
106 0.81
107 0.8
108 0.72
109 0.64
110 0.55
111 0.44
112 0.34
113 0.27
114 0.2
115 0.11
116 0.09
117 0.06
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.09
125 0.09
126 0.1
127 0.15
128 0.22
129 0.29
130 0.32
131 0.33
132 0.38
133 0.39
134 0.4
135 0.41
136 0.37
137 0.31
138 0.29
139 0.27
140 0.21
141 0.19
142 0.16
143 0.1
144 0.05
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.05
153 0.07
154 0.1
155 0.16
156 0.19
157 0.23
158 0.24
159 0.26
160 0.26
161 0.26
162 0.24
163 0.22
164 0.22
165 0.2
166 0.22
167 0.21
168 0.21
169 0.19
170 0.18
171 0.14
172 0.11
173 0.1
174 0.07
175 0.07
176 0.07
177 0.1
178 0.14
179 0.14
180 0.15
181 0.17
182 0.18
183 0.17
184 0.19
185 0.21
186 0.21
187 0.22
188 0.22
189 0.2
190 0.2
191 0.21
192 0.26
193 0.23
194 0.21
195 0.19
196 0.21
197 0.23
198 0.3
199 0.31
200 0.26
201 0.25
202 0.25
203 0.26
204 0.25
205 0.25
206 0.18
207 0.16
208 0.17
209 0.18
210 0.23
211 0.23
212 0.26
213 0.26
214 0.29
215 0.27
216 0.26
217 0.23
218 0.19
219 0.19
220 0.13
221 0.15
222 0.15
223 0.16
224 0.19
225 0.23
226 0.22
227 0.25
228 0.32
229 0.35
230 0.34
231 0.33
232 0.32
233 0.29
234 0.28
235 0.26
236 0.19
237 0.12
238 0.1
239 0.1
240 0.08
241 0.07
242 0.07
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.06
250 0.09
251 0.13
252 0.14
253 0.16
254 0.17
255 0.2
256 0.24
257 0.29
258 0.33
259 0.31
260 0.3
261 0.29
262 0.28
263 0.27
264 0.23
265 0.18
266 0.11
267 0.09
268 0.1
269 0.1
270 0.1
271 0.09
272 0.1
273 0.13
274 0.12
275 0.12
276 0.12
277 0.11
278 0.1
279 0.14
280 0.14
281 0.11
282 0.12
283 0.12
284 0.12
285 0.14
286 0.14
287 0.14
288 0.14
289 0.19
290 0.21
291 0.25
292 0.26
293 0.27
294 0.31
295 0.3
296 0.33
297 0.29
298 0.29
299 0.27
300 0.26
301 0.23
302 0.19
303 0.16
304 0.14
305 0.13
306 0.12
307 0.12
308 0.12
309 0.15
310 0.2
311 0.22
312 0.21
313 0.22
314 0.28
315 0.31
316 0.32
317 0.35
318 0.33
319 0.36
320 0.41
321 0.47
322 0.48
323 0.53
324 0.61
325 0.6
326 0.64
327 0.6
328 0.55
329 0.56
330 0.52
331 0.48
332 0.45
333 0.44
334 0.38
335 0.39
336 0.37
337 0.29
338 0.29
339 0.26
340 0.21
341 0.19
342 0.18
343 0.18
344 0.18
345 0.26
346 0.23
347 0.24
348 0.24
349 0.26
350 0.3
351 0.29
352 0.29
353 0.23
354 0.27
355 0.26
356 0.24
357 0.26
358 0.21
359 0.2
360 0.2
361 0.18
362 0.12
363 0.1
364 0.1
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.05
371 0.06
372 0.1
373 0.12
374 0.13
375 0.14
376 0.16
377 0.17
378 0.17
379 0.17
380 0.16
381 0.18
382 0.24
383 0.24
384 0.23
385 0.22
386 0.22
387 0.22
388 0.19
389 0.16
390 0.09
391 0.11
392 0.11
393 0.1
394 0.09
395 0.11
396 0.12
397 0.15
398 0.16
399 0.14
400 0.17
401 0.25
402 0.34
403 0.44
404 0.51
405 0.57
406 0.68
407 0.71
408 0.74
409 0.74
410 0.74
411 0.71
412 0.72
413 0.66
414 0.59
415 0.64
416 0.6
417 0.58
418 0.5
419 0.44
420 0.35
421 0.35
422 0.31