Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H0ZGM3

Protein Details
Accession A0A2H0ZGM3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
66-89KETDIMKWRKKQINKANNAKIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLPLRFLATRSLSASVAARESICPAGTVLNLKIRKSGDEPVALKDEEYPEWLWDCLNKEKMDQQLKETDIMKWRKKQINKANNAKIKNNNFVSQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.18
4 0.16
5 0.14
6 0.12
7 0.14
8 0.14
9 0.12
10 0.11
11 0.1
12 0.1
13 0.11
14 0.13
15 0.12
16 0.19
17 0.2
18 0.2
19 0.24
20 0.23
21 0.25
22 0.26
23 0.29
24 0.24
25 0.28
26 0.29
27 0.27
28 0.29
29 0.27
30 0.24
31 0.2
32 0.18
33 0.13
34 0.14
35 0.12
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.13
42 0.16
43 0.2
44 0.2
45 0.2
46 0.25
47 0.33
48 0.39
49 0.36
50 0.34
51 0.36
52 0.37
53 0.39
54 0.36
55 0.31
56 0.31
57 0.39
58 0.43
59 0.44
60 0.53
61 0.58
62 0.65
63 0.72
64 0.75
65 0.77
66 0.81
67 0.84
68 0.85
69 0.84
70 0.82
71 0.79
72 0.78
73 0.74
74 0.73
75 0.67