Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XJ35

Protein Details
Accession A0A2B7XJ35    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-47KVEPQEKKKTPKGRAKKRLQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
14-38VKSQTPKVEPQEKKKTPKGRAKKRL
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.46
5 0.48
6 0.57
7 0.59
8 0.64
9 0.64
10 0.66
11 0.69
12 0.71
13 0.74
14 0.73
15 0.74
16 0.73
17 0.78
18 0.79
19 0.79
20 0.83
21 0.86
22 0.87
23 0.89
24 0.9
25 0.89
26 0.88
27 0.84
28 0.84
29 0.8
30 0.72
31 0.62
32 0.6
33 0.54
34 0.48
35 0.46
36 0.4
37 0.39
38 0.41