Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MJR3

Protein Details
Accession B8MJR3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-108LRAANEKEKQKRKRSRAQISHQGSLHydrophilic
NLS Segment(s)
PositionSequence
92-100KEKQKRKRS
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MASPLTWYXXWRIKLKISEWLQGNWIGAIDPDRVYQKLTVQLRTPTPPPSRSSPFEVVDQAINRLSKAYEMSRNELLIIQKEVHDLRAANEKEKQKRKRSRAQISHQGSLTAQEAQELITSRGEASQPLPAAPVESEPQASQPRVRAPPKCSGCGIVGHRINRCPNRTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.54
4 0.48
5 0.46
6 0.43
7 0.38
8 0.35
9 0.24
10 0.2
11 0.13
12 0.11
13 0.12
14 0.11
15 0.1
16 0.12
17 0.14
18 0.14
19 0.16
20 0.17
21 0.18
22 0.25
23 0.28
24 0.29
25 0.3
26 0.34
27 0.36
28 0.38
29 0.38
30 0.37
31 0.39
32 0.39
33 0.4
34 0.43
35 0.45
36 0.45
37 0.5
38 0.47
39 0.43
40 0.41
41 0.39
42 0.33
43 0.29
44 0.26
45 0.2
46 0.17
47 0.16
48 0.13
49 0.13
50 0.11
51 0.1
52 0.12
53 0.14
54 0.18
55 0.2
56 0.24
57 0.25
58 0.25
59 0.24
60 0.24
61 0.21
62 0.16
63 0.15
64 0.11
65 0.1
66 0.12
67 0.12
68 0.11
69 0.11
70 0.09
71 0.09
72 0.18
73 0.18
74 0.18
75 0.24
76 0.3
77 0.39
78 0.48
79 0.56
80 0.58
81 0.68
82 0.75
83 0.79
84 0.83
85 0.85
86 0.85
87 0.85
88 0.85
89 0.8
90 0.75
91 0.65
92 0.54
93 0.43
94 0.35
95 0.27
96 0.18
97 0.12
98 0.09
99 0.09
100 0.08
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.09
107 0.1
108 0.1
109 0.1
110 0.1
111 0.12
112 0.12
113 0.12
114 0.13
115 0.12
116 0.13
117 0.12
118 0.13
119 0.11
120 0.11
121 0.13
122 0.12
123 0.17
124 0.2
125 0.22
126 0.22
127 0.25
128 0.32
129 0.39
130 0.47
131 0.49
132 0.49
133 0.58
134 0.61
135 0.61
136 0.55
137 0.49
138 0.43
139 0.44
140 0.43
141 0.42
142 0.42
143 0.44
144 0.46
145 0.49
146 0.57
147 0.58
148 0.59