Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XEW3

Protein Details
Accession A0A2B7XEW3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
221-246DSSVGFGDKKRRRKKTQPDNPQSLDSHydrophilic
NLS Segment(s)
PositionSequence
229-235KKRRRKK
Subcellular Location(s) mito 12, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016137  RGS  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
Pfam View protein in Pfam  
PF00615  RGS  
Amino Acid Sequences MACRIFDRCCVPPNGPPRTVTGARDVNKQSRVTKLPGAWRGQEGLSFDMIIGGCTCPPCTVRDFMNYLKYVERNAENLQFFLWYRDYSRRFALIAESQRQLSPEWIEKIKRVGDGSGQPTPTVPLSPAVTIVTEGQSEFTQLPTSIHTAPFSTPPRSPIYPDDDWTTPSRTGKVDGNSSPRTQRSEQDISSGQVVDNADSINARPAAAGKTEASSEAKCNDSSVGFGDKKRRRKKTQPDNPQSLDSSQPYRNELTRIYATYIADGASRQLNLTSQERDNLNRALACTTHPSAFKQVAAQVEWTLRQQSHPNPTLSAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.49
4 0.48
5 0.51
6 0.52
7 0.46
8 0.45
9 0.46
10 0.46
11 0.53
12 0.53
13 0.52
14 0.55
15 0.57
16 0.52
17 0.51
18 0.54
19 0.5
20 0.51
21 0.5
22 0.53
23 0.56
24 0.57
25 0.51
26 0.48
27 0.46
28 0.4
29 0.36
30 0.29
31 0.24
32 0.19
33 0.17
34 0.14
35 0.14
36 0.14
37 0.12
38 0.1
39 0.09
40 0.09
41 0.1
42 0.11
43 0.1
44 0.11
45 0.13
46 0.16
47 0.18
48 0.2
49 0.24
50 0.28
51 0.3
52 0.37
53 0.35
54 0.34
55 0.34
56 0.33
57 0.29
58 0.29
59 0.27
60 0.23
61 0.25
62 0.3
63 0.27
64 0.26
65 0.25
66 0.22
67 0.21
68 0.2
69 0.18
70 0.13
71 0.16
72 0.24
73 0.27
74 0.29
75 0.31
76 0.29
77 0.28
78 0.27
79 0.29
80 0.27
81 0.3
82 0.31
83 0.3
84 0.29
85 0.29
86 0.29
87 0.25
88 0.21
89 0.18
90 0.19
91 0.21
92 0.24
93 0.25
94 0.26
95 0.3
96 0.29
97 0.28
98 0.24
99 0.21
100 0.21
101 0.26
102 0.28
103 0.28
104 0.26
105 0.24
106 0.23
107 0.23
108 0.2
109 0.15
110 0.1
111 0.09
112 0.1
113 0.1
114 0.11
115 0.09
116 0.09
117 0.09
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.11
132 0.11
133 0.11
134 0.11
135 0.11
136 0.12
137 0.17
138 0.19
139 0.19
140 0.19
141 0.21
142 0.26
143 0.25
144 0.27
145 0.25
146 0.28
147 0.27
148 0.28
149 0.28
150 0.24
151 0.25
152 0.25
153 0.24
154 0.19
155 0.18
156 0.19
157 0.16
158 0.18
159 0.2
160 0.21
161 0.22
162 0.24
163 0.3
164 0.3
165 0.32
166 0.33
167 0.31
168 0.33
169 0.31
170 0.32
171 0.33
172 0.35
173 0.34
174 0.34
175 0.34
176 0.29
177 0.29
178 0.25
179 0.17
180 0.14
181 0.14
182 0.1
183 0.09
184 0.08
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.08
191 0.07
192 0.08
193 0.1
194 0.1
195 0.12
196 0.09
197 0.1
198 0.1
199 0.12
200 0.13
201 0.13
202 0.14
203 0.14
204 0.16
205 0.15
206 0.15
207 0.15
208 0.13
209 0.13
210 0.13
211 0.17
212 0.18
213 0.21
214 0.31
215 0.37
216 0.48
217 0.57
218 0.65
219 0.69
220 0.78
221 0.86
222 0.87
223 0.91
224 0.92
225 0.91
226 0.9
227 0.84
228 0.76
229 0.67
230 0.57
231 0.5
232 0.42
233 0.37
234 0.32
235 0.31
236 0.3
237 0.31
238 0.32
239 0.3
240 0.28
241 0.29
242 0.28
243 0.28
244 0.28
245 0.28
246 0.26
247 0.24
248 0.23
249 0.17
250 0.14
251 0.12
252 0.11
253 0.11
254 0.11
255 0.1
256 0.1
257 0.12
258 0.16
259 0.2
260 0.23
261 0.23
262 0.27
263 0.3
264 0.32
265 0.35
266 0.33
267 0.32
268 0.28
269 0.28
270 0.25
271 0.23
272 0.22
273 0.25
274 0.25
275 0.26
276 0.26
277 0.28
278 0.33
279 0.34
280 0.33
281 0.29
282 0.3
283 0.3
284 0.3
285 0.28
286 0.25
287 0.25
288 0.26
289 0.25
290 0.26
291 0.23
292 0.25
293 0.31
294 0.37
295 0.45
296 0.49
297 0.49
298 0.46