Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WJ35

Protein Details
Accession A0A2B7WJ35   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
112-133TGEDPKLKRKRVQLRKEISELEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003130  GED  
IPR020850  GED_dom  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF02212  GED  
PROSITE View protein in PROSITE  
PS51388  GED  
Amino Acid Sequences MDPLVEIYQRSLFQKRIETAMRKQTVTDCSHGTVVRFRDIVHQNHMSNVEHTVHDLHDTLKPYYKVAQKRFVDSVCMQAVDYHLITGPQTPLKQFSPAFVQGLSAEQLGEITGEDPKLKRKRVQLRKEISELEAGRKILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.4
4 0.46
5 0.48
6 0.51
7 0.58
8 0.57
9 0.5
10 0.5
11 0.48
12 0.47
13 0.45
14 0.4
15 0.32
16 0.3
17 0.32
18 0.31
19 0.27
20 0.26
21 0.24
22 0.24
23 0.22
24 0.21
25 0.27
26 0.32
27 0.34
28 0.35
29 0.38
30 0.35
31 0.37
32 0.38
33 0.31
34 0.25
35 0.24
36 0.19
37 0.14
38 0.15
39 0.14
40 0.11
41 0.11
42 0.11
43 0.1
44 0.11
45 0.14
46 0.14
47 0.18
48 0.18
49 0.18
50 0.23
51 0.28
52 0.33
53 0.35
54 0.44
55 0.41
56 0.44
57 0.45
58 0.4
59 0.38
60 0.3
61 0.3
62 0.21
63 0.2
64 0.16
65 0.14
66 0.15
67 0.12
68 0.11
69 0.07
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08
75 0.1
76 0.1
77 0.11
78 0.15
79 0.16
80 0.2
81 0.19
82 0.19
83 0.22
84 0.24
85 0.24
86 0.2
87 0.2
88 0.16
89 0.17
90 0.16
91 0.1
92 0.08
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.05
100 0.06
101 0.09
102 0.1
103 0.2
104 0.28
105 0.34
106 0.4
107 0.49
108 0.6
109 0.69
110 0.78
111 0.79
112 0.81
113 0.82
114 0.82
115 0.74
116 0.65
117 0.62
118 0.53
119 0.48
120 0.43