Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XED5

Protein Details
Accession A0A2B7XED5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-27GLVPWIKSIHRRRQNTSKRLVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MDCFGGLVPWIKSIHRRRQNTSKRLVIGPPTDFRRVEFTMAHYDKEDALSDETPSDSSALYRVSKREKLYHEAKMLKERLAENTDVVRLRLLRQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.58
4 0.63
5 0.74
6 0.83
7 0.82
8 0.81
9 0.77
10 0.7
11 0.66
12 0.61
13 0.55
14 0.49
15 0.44
16 0.41
17 0.38
18 0.38
19 0.35
20 0.33
21 0.34
22 0.3
23 0.29
24 0.24
25 0.22
26 0.28
27 0.29
28 0.28
29 0.23
30 0.22
31 0.2
32 0.2
33 0.18
34 0.09
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.06
46 0.08
47 0.1
48 0.12
49 0.16
50 0.23
51 0.28
52 0.31
53 0.37
54 0.4
55 0.45
56 0.5
57 0.52
58 0.54
59 0.54
60 0.54
61 0.55
62 0.53
63 0.47
64 0.45
65 0.39
66 0.37
67 0.36
68 0.34
69 0.27
70 0.27
71 0.3
72 0.27
73 0.26
74 0.23
75 0.2
76 0.22