Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X5N7

Protein Details
Accession A0A2B7X5N7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-44SIMGINRRQRNKKESTRETYKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009598  BC10  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSHDPHMTRRLGLLIEKVPGAGSIMGINRRQRNKKESTRETYKPCCNYSWVMMVASGPTLYVTSDTFSYYIGDWFAPRFPAPASPSALEHSATAGLAEYVLETVNTTATALAGAAVDEVKKHFASNNGTGVVGDSRMEWTGMGLEWLRSLLGRREWTLPCVDVKVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.18
6 0.16
7 0.15
8 0.1
9 0.08
10 0.09
11 0.12
12 0.16
13 0.2
14 0.27
15 0.33
16 0.43
17 0.51
18 0.56
19 0.62
20 0.68
21 0.74
22 0.78
23 0.8
24 0.8
25 0.8
26 0.8
27 0.79
28 0.78
29 0.76
30 0.7
31 0.63
32 0.55
33 0.5
34 0.45
35 0.4
36 0.35
37 0.28
38 0.23
39 0.2
40 0.19
41 0.15
42 0.13
43 0.09
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.07
67 0.11
68 0.13
69 0.15
70 0.16
71 0.16
72 0.17
73 0.17
74 0.18
75 0.14
76 0.12
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.05
106 0.07
107 0.08
108 0.08
109 0.1
110 0.15
111 0.21
112 0.25
113 0.28
114 0.26
115 0.26
116 0.25
117 0.25
118 0.2
119 0.14
120 0.1
121 0.08
122 0.08
123 0.09
124 0.09
125 0.08
126 0.07
127 0.08
128 0.08
129 0.09
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.08
136 0.11
137 0.15
138 0.21
139 0.25
140 0.27
141 0.34
142 0.36
143 0.38
144 0.39
145 0.35
146 0.31
147 0.32