Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7XH53

Protein Details
Accession A0A2B7XH53    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
298-357VDVSRRRGERRTRRQSSGSTPRNCDRNGPRHNRGRLLDSYRPPPTTPRGKCHNRKVSMSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, nucl 12.5, cyto 11, cyto_mito 7.999
Family & Domain DBs
Amino Acid Sequences MSNDAPVAVNIQQCVRVNPYHLVGPNSDIEEREVITTVSRPKSHAIFSSKQIRLLGPLPSNQGGIPLRELLVGIGNRQGSSPKPAEDLPNPASTAYYAHYGDAALSAEQFEVMWQFDRFAKTGKVAGLDDRVRVRILTLRDTVQAARSAFHEPSRTYVYEGWTEAHFALFFEEYCAFKAAASVAIDALDNAPTSNWADVKPPRGLNEDELSRYFTDTQQRLPGSPNRLSKLDLTLDNLIEVNARREKAKIVVTTIRRPDNIYGQRRLNRLRPSQHRQAGRHHNEPLAQRVEYPSFPSVDVSRRRGERRTRRQSSGSTPRNCDRNGPRHNRGRLLDSYRPPPTTPRGKCHNRKVSMSSSEENFIILNYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.29
5 0.31
6 0.33
7 0.33
8 0.35
9 0.34
10 0.3
11 0.31
12 0.3
13 0.29
14 0.28
15 0.23
16 0.22
17 0.21
18 0.21
19 0.18
20 0.16
21 0.13
22 0.14
23 0.17
24 0.22
25 0.27
26 0.28
27 0.29
28 0.33
29 0.36
30 0.38
31 0.42
32 0.42
33 0.4
34 0.46
35 0.54
36 0.51
37 0.51
38 0.49
39 0.42
40 0.38
41 0.37
42 0.36
43 0.29
44 0.3
45 0.31
46 0.31
47 0.31
48 0.26
49 0.29
50 0.24
51 0.22
52 0.21
53 0.18
54 0.17
55 0.16
56 0.17
57 0.11
58 0.14
59 0.13
60 0.12
61 0.15
62 0.15
63 0.15
64 0.15
65 0.17
66 0.14
67 0.2
68 0.22
69 0.2
70 0.22
71 0.24
72 0.29
73 0.3
74 0.35
75 0.32
76 0.32
77 0.3
78 0.28
79 0.26
80 0.21
81 0.2
82 0.14
83 0.14
84 0.12
85 0.12
86 0.12
87 0.11
88 0.11
89 0.1
90 0.1
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.07
102 0.08
103 0.11
104 0.13
105 0.14
106 0.16
107 0.16
108 0.16
109 0.19
110 0.19
111 0.18
112 0.17
113 0.18
114 0.22
115 0.22
116 0.23
117 0.21
118 0.21
119 0.19
120 0.18
121 0.17
122 0.16
123 0.17
124 0.19
125 0.19
126 0.2
127 0.21
128 0.22
129 0.21
130 0.19
131 0.2
132 0.16
133 0.14
134 0.15
135 0.17
136 0.16
137 0.18
138 0.19
139 0.16
140 0.19
141 0.22
142 0.21
143 0.2
144 0.21
145 0.22
146 0.2
147 0.2
148 0.18
149 0.14
150 0.15
151 0.13
152 0.11
153 0.09
154 0.07
155 0.07
156 0.06
157 0.06
158 0.07
159 0.08
160 0.08
161 0.09
162 0.1
163 0.09
164 0.08
165 0.09
166 0.08
167 0.09
168 0.08
169 0.08
170 0.06
171 0.07
172 0.07
173 0.06
174 0.06
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.06
182 0.06
183 0.07
184 0.11
185 0.14
186 0.18
187 0.21
188 0.22
189 0.23
190 0.26
191 0.27
192 0.25
193 0.27
194 0.24
195 0.22
196 0.22
197 0.22
198 0.18
199 0.18
200 0.16
201 0.15
202 0.22
203 0.21
204 0.23
205 0.26
206 0.27
207 0.26
208 0.3
209 0.32
210 0.3
211 0.36
212 0.39
213 0.36
214 0.37
215 0.37
216 0.34
217 0.33
218 0.3
219 0.24
220 0.22
221 0.21
222 0.2
223 0.19
224 0.17
225 0.13
226 0.12
227 0.11
228 0.13
229 0.14
230 0.15
231 0.15
232 0.16
233 0.18
234 0.21
235 0.26
236 0.23
237 0.25
238 0.32
239 0.37
240 0.43
241 0.47
242 0.46
243 0.41
244 0.42
245 0.39
246 0.42
247 0.47
248 0.46
249 0.47
250 0.51
251 0.56
252 0.59
253 0.62
254 0.59
255 0.59
256 0.6
257 0.64
258 0.66
259 0.69
260 0.74
261 0.76
262 0.76
263 0.71
264 0.73
265 0.74
266 0.72
267 0.7
268 0.63
269 0.58
270 0.55
271 0.54
272 0.51
273 0.43
274 0.36
275 0.31
276 0.31
277 0.32
278 0.28
279 0.29
280 0.24
281 0.21
282 0.21
283 0.22
284 0.21
285 0.26
286 0.32
287 0.33
288 0.38
289 0.44
290 0.48
291 0.55
292 0.63
293 0.67
294 0.71
295 0.77
296 0.79
297 0.79
298 0.8
299 0.79
300 0.78
301 0.78
302 0.76
303 0.72
304 0.71
305 0.7
306 0.71
307 0.65
308 0.63
309 0.62
310 0.63
311 0.67
312 0.7
313 0.73
314 0.77
315 0.82
316 0.81
317 0.74
318 0.7
319 0.68
320 0.66
321 0.66
322 0.62
323 0.64
324 0.61
325 0.6
326 0.56
327 0.54
328 0.55
329 0.56
330 0.57
331 0.58
332 0.63
333 0.71
334 0.8
335 0.85
336 0.86
337 0.82
338 0.82
339 0.8
340 0.78
341 0.75
342 0.71
343 0.65
344 0.57
345 0.52
346 0.45
347 0.39
348 0.3