Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MSD9

Protein Details
Accession B8MSD9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSEQKPKIPKRRRLLRKKPNDRDSDENDVBasic
NLS Segment(s)
PositionSequence
5-19KPKIPKRRRLLRKKP
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSEQKPKIPKRRRLLRKKPNDRDSDENDVNNAYLCDTEGYALDNLHYYKIRLPDGREIQTRPRLNNYVDLVVGPAGSSDRFFLREESWRTEAVTEIHLKIVNYEIDYYLDPNERTGIVFAMWQELDSQDNHFVIRGRRFGGRNFIGYLNEGERYDFSLGTYDTDTSLNTIALSCSSDLTFEVEFVCMSEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.96
5 0.96
6 0.95
7 0.92
8 0.87
9 0.84
10 0.8
11 0.78
12 0.7
13 0.6
14 0.51
15 0.43
16 0.36
17 0.28
18 0.21
19 0.11
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.07
26 0.09
27 0.09
28 0.09
29 0.08
30 0.1
31 0.1
32 0.12
33 0.12
34 0.11
35 0.15
36 0.19
37 0.24
38 0.25
39 0.28
40 0.35
41 0.41
42 0.45
43 0.45
44 0.44
45 0.46
46 0.53
47 0.53
48 0.46
49 0.46
50 0.44
51 0.42
52 0.45
53 0.4
54 0.32
55 0.28
56 0.26
57 0.2
58 0.15
59 0.14
60 0.07
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.08
68 0.08
69 0.1
70 0.12
71 0.19
72 0.22
73 0.26
74 0.27
75 0.26
76 0.25
77 0.24
78 0.23
79 0.17
80 0.16
81 0.12
82 0.1
83 0.11
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.08
90 0.09
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.08
104 0.06
105 0.07
106 0.07
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.09
113 0.08
114 0.1
115 0.1
116 0.1
117 0.1
118 0.11
119 0.13
120 0.18
121 0.22
122 0.22
123 0.22
124 0.28
125 0.3
126 0.32
127 0.38
128 0.35
129 0.33
130 0.33
131 0.32
132 0.28
133 0.27
134 0.27
135 0.19
136 0.18
137 0.16
138 0.15
139 0.14
140 0.16
141 0.16
142 0.13
143 0.12
144 0.13
145 0.13
146 0.14
147 0.15
148 0.13
149 0.13
150 0.13
151 0.13
152 0.11
153 0.12
154 0.1
155 0.09
156 0.09
157 0.08
158 0.09
159 0.1
160 0.09
161 0.1
162 0.1
163 0.1
164 0.1
165 0.13
166 0.12
167 0.11
168 0.11
169 0.1
170 0.1
171 0.1