Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XLQ3

Protein Details
Accession A0A2B7XLQ3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-32VLSEKPALRNCRRKQDKAEDQAKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002836  PDCD5-like  
IPR036883  PDCD5-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF01984  dsDNA_bind  
Amino Acid Sequences MADAELEEVLSEKPALRNCRRKQDKAEDQAKVQTRNRDTDARQAILSQILLPEAADRLGRIRMVKEERAADIENRLIMLARTGQLRAKVTEEQLKELLNAVAENKEEEKIVISRRKGGWDDDDDDDLLNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.29
3 0.38
4 0.48
5 0.55
6 0.66
7 0.73
8 0.77
9 0.8
10 0.83
11 0.83
12 0.83
13 0.84
14 0.75
15 0.69
16 0.68
17 0.64
18 0.6
19 0.54
20 0.52
21 0.47
22 0.49
23 0.5
24 0.49
25 0.46
26 0.48
27 0.48
28 0.41
29 0.38
30 0.33
31 0.3
32 0.24
33 0.22
34 0.12
35 0.08
36 0.06
37 0.06
38 0.06
39 0.05
40 0.04
41 0.05
42 0.04
43 0.04
44 0.06
45 0.07
46 0.08
47 0.08
48 0.09
49 0.14
50 0.18
51 0.2
52 0.21
53 0.21
54 0.21
55 0.23
56 0.23
57 0.17
58 0.15
59 0.14
60 0.12
61 0.1
62 0.1
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.1
71 0.14
72 0.16
73 0.16
74 0.18
75 0.19
76 0.22
77 0.28
78 0.28
79 0.27
80 0.27
81 0.26
82 0.23
83 0.22
84 0.19
85 0.12
86 0.12
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.12
93 0.11
94 0.11
95 0.13
96 0.15
97 0.23
98 0.28
99 0.29
100 0.35
101 0.37
102 0.44
103 0.43
104 0.44
105 0.43
106 0.42
107 0.45
108 0.41
109 0.41
110 0.35