Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7X4E7

Protein Details
Accession A0A2B7X4E7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-53GGSVRHHLRRRTFPFRKSRRSKPRRWPLVLRFIKGBasic
NLS Segment(s)
PositionSequence
23-44RHHLRRRTFPFRKSRRSKPRRW
Subcellular Location(s) plas 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021134  Bestrophin-like  
IPR044669  YneE/VCCN1/2-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005254  F:chloride channel activity  
Pfam View protein in Pfam  
PF01062  Bestrophin  
Amino Acid Sequences MRFTEPPLPHSPVKNGSGGGSVRHHLRRRTFPFRKSRRSKPRRWPLVLRFIKGAIHAAILIPVLLHALFTALVVYLDKYVYTHLGLPATIIPSLSIVVGLILVFRNQTSYNRFWDGRNNLAAINTSVRNLTRSILTHAYNRQAGPPTLAEKNDVERTIRVLMAVPFAVKSYLRAEWGAAWAPNPDAGGATDGGGGSASLSHAVESSMILRHPDRNGNVNGTSAGAGRVADGDNGDDHEDGVRVFNPEYDSLLPMGMQAYEDEGLGLPLQLTFFIDGFIKRGLERGWFSAPGASNLQAQLNALTDAYGRMETIKLTPIPIAHLIHQKQVLALFGAVLPFAMVDEMGWWAVPIVSLVIFTLYGIEGIGSQLEDPFGYDRNDIKMDAIVEDERVEIEAILNEWKKVTVVRGEDGLVGVGGGGDDGGYEPMEMFIRMRTATRDRDGGVRNGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.37
4 0.38
5 0.34
6 0.31
7 0.28
8 0.28
9 0.32
10 0.4
11 0.46
12 0.48
13 0.56
14 0.62
15 0.68
16 0.76
17 0.78
18 0.8
19 0.84
20 0.87
21 0.89
22 0.88
23 0.9
24 0.9
25 0.92
26 0.93
27 0.93
28 0.93
29 0.93
30 0.92
31 0.91
32 0.89
33 0.9
34 0.86
35 0.78
36 0.69
37 0.59
38 0.52
39 0.42
40 0.35
41 0.25
42 0.18
43 0.15
44 0.13
45 0.12
46 0.11
47 0.09
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.12
70 0.13
71 0.14
72 0.14
73 0.14
74 0.15
75 0.14
76 0.13
77 0.11
78 0.09
79 0.09
80 0.09
81 0.08
82 0.06
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.07
93 0.09
94 0.13
95 0.19
96 0.22
97 0.27
98 0.32
99 0.33
100 0.33
101 0.41
102 0.42
103 0.41
104 0.4
105 0.36
106 0.3
107 0.3
108 0.29
109 0.21
110 0.2
111 0.15
112 0.13
113 0.14
114 0.14
115 0.14
116 0.14
117 0.14
118 0.14
119 0.15
120 0.19
121 0.22
122 0.23
123 0.26
124 0.29
125 0.32
126 0.32
127 0.31
128 0.3
129 0.29
130 0.28
131 0.25
132 0.24
133 0.23
134 0.23
135 0.23
136 0.22
137 0.2
138 0.23
139 0.24
140 0.23
141 0.21
142 0.19
143 0.21
144 0.2
145 0.19
146 0.15
147 0.13
148 0.13
149 0.13
150 0.12
151 0.1
152 0.08
153 0.08
154 0.09
155 0.07
156 0.08
157 0.1
158 0.11
159 0.12
160 0.12
161 0.12
162 0.12
163 0.14
164 0.14
165 0.11
166 0.1
167 0.1
168 0.1
169 0.1
170 0.09
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.06
195 0.07
196 0.08
197 0.11
198 0.13
199 0.17
200 0.18
201 0.22
202 0.23
203 0.25
204 0.24
205 0.22
206 0.2
207 0.16
208 0.15
209 0.1
210 0.09
211 0.06
212 0.05
213 0.05
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.05
223 0.05
224 0.06
225 0.06
226 0.05
227 0.06
228 0.06
229 0.06
230 0.07
231 0.08
232 0.09
233 0.09
234 0.11
235 0.11
236 0.11
237 0.1
238 0.1
239 0.09
240 0.07
241 0.07
242 0.05
243 0.05
244 0.04
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.03
254 0.03
255 0.04
256 0.03
257 0.04
258 0.04
259 0.04
260 0.05
261 0.06
262 0.06
263 0.08
264 0.09
265 0.09
266 0.08
267 0.1
268 0.1
269 0.13
270 0.15
271 0.16
272 0.18
273 0.18
274 0.18
275 0.2
276 0.2
277 0.18
278 0.19
279 0.16
280 0.15
281 0.15
282 0.16
283 0.12
284 0.12
285 0.1
286 0.09
287 0.08
288 0.07
289 0.06
290 0.06
291 0.06
292 0.07
293 0.06
294 0.06
295 0.06
296 0.07
297 0.07
298 0.08
299 0.12
300 0.11
301 0.12
302 0.13
303 0.12
304 0.15
305 0.18
306 0.18
307 0.18
308 0.26
309 0.26
310 0.29
311 0.3
312 0.28
313 0.25
314 0.24
315 0.21
316 0.13
317 0.12
318 0.08
319 0.08
320 0.07
321 0.06
322 0.05
323 0.05
324 0.04
325 0.04
326 0.03
327 0.03
328 0.02
329 0.03
330 0.04
331 0.04
332 0.04
333 0.04
334 0.04
335 0.04
336 0.05
337 0.04
338 0.04
339 0.04
340 0.04
341 0.04
342 0.05
343 0.05
344 0.04
345 0.05
346 0.05
347 0.05
348 0.04
349 0.04
350 0.04
351 0.05
352 0.05
353 0.04
354 0.04
355 0.05
356 0.05
357 0.05
358 0.06
359 0.08
360 0.1
361 0.12
362 0.14
363 0.16
364 0.2
365 0.22
366 0.21
367 0.2
368 0.2
369 0.19
370 0.17
371 0.18
372 0.14
373 0.13
374 0.13
375 0.12
376 0.1
377 0.1
378 0.1
379 0.07
380 0.08
381 0.08
382 0.08
383 0.15
384 0.15
385 0.15
386 0.15
387 0.15
388 0.15
389 0.16
390 0.2
391 0.21
392 0.24
393 0.26
394 0.27
395 0.28
396 0.28
397 0.26
398 0.22
399 0.14
400 0.1
401 0.07
402 0.05
403 0.04
404 0.03
405 0.03
406 0.02
407 0.03
408 0.03
409 0.04
410 0.05
411 0.05
412 0.05
413 0.07
414 0.08
415 0.09
416 0.09
417 0.1
418 0.12
419 0.13
420 0.15
421 0.21
422 0.27
423 0.34
424 0.38
425 0.41
426 0.4
427 0.47
428 0.5