Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WIG2

Protein Details
Accession A0A2B7WIG2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
173-199SGPHPPVATKKKNKDKKPPPPSTQRLPHydrophilic
NLS Segment(s)
PositionSequence
181-192TKKKNKDKKPPP
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, pero 4
Family & Domain DBs
Amino Acid Sequences MYTDEKLAHMTYLFNNHNLDPATSGRTQEVLNREASPSAHEKFPPIPRLFEGWTLRRAGADTSKVVSNWDQVTRERMPFTQEELEKKVTNPNNEDVQEKYPALGSGKRKQIQQLMIDRKAYDGDNRFSWHCVYIRTDKKTVNVRKFIKEYVTVSLSVILLRQVREGIVLPPLSGPHPPVATKKKNKDKKPPPPSTQRLPEATATVEQPRPQHHGGTAGGQRQNTATNHINPPMGPEAPLVGAQHGGFTSWQQELPQMPLQGQQDQYTQSARHVQPAHPAQLPQPAQLTHPTNPPHPTHPTHPTHPTYPHPTHPTHPAHPAQYTQHTHPSQQTQQTQHAQHAQHAQPQHAQPQHAQPQHAQPQHAQPQHAQPQHAQHAQHAQAHVHTQPSQYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.32
5 0.31
6 0.28
7 0.22
8 0.23
9 0.25
10 0.24
11 0.25
12 0.22
13 0.22
14 0.22
15 0.25
16 0.29
17 0.26
18 0.27
19 0.27
20 0.27
21 0.27
22 0.27
23 0.26
24 0.26
25 0.26
26 0.28
27 0.27
28 0.29
29 0.35
30 0.43
31 0.48
32 0.44
33 0.44
34 0.43
35 0.47
36 0.46
37 0.46
38 0.46
39 0.4
40 0.42
41 0.41
42 0.39
43 0.34
44 0.33
45 0.28
46 0.27
47 0.27
48 0.25
49 0.25
50 0.26
51 0.26
52 0.27
53 0.25
54 0.24
55 0.24
56 0.26
57 0.26
58 0.26
59 0.33
60 0.34
61 0.36
62 0.33
63 0.3
64 0.31
65 0.3
66 0.34
67 0.35
68 0.34
69 0.36
70 0.38
71 0.42
72 0.38
73 0.37
74 0.41
75 0.38
76 0.41
77 0.41
78 0.41
79 0.43
80 0.43
81 0.43
82 0.38
83 0.35
84 0.32
85 0.28
86 0.24
87 0.18
88 0.19
89 0.19
90 0.22
91 0.26
92 0.3
93 0.4
94 0.43
95 0.44
96 0.48
97 0.53
98 0.52
99 0.53
100 0.55
101 0.54
102 0.55
103 0.54
104 0.49
105 0.42
106 0.38
107 0.32
108 0.28
109 0.24
110 0.23
111 0.24
112 0.27
113 0.27
114 0.27
115 0.27
116 0.24
117 0.2
118 0.19
119 0.22
120 0.29
121 0.36
122 0.4
123 0.43
124 0.41
125 0.46
126 0.54
127 0.58
128 0.57
129 0.59
130 0.58
131 0.6
132 0.61
133 0.57
134 0.5
135 0.45
136 0.38
137 0.33
138 0.3
139 0.24
140 0.21
141 0.2
142 0.17
143 0.13
144 0.11
145 0.1
146 0.1
147 0.09
148 0.1
149 0.09
150 0.09
151 0.09
152 0.1
153 0.09
154 0.1
155 0.1
156 0.09
157 0.09
158 0.1
159 0.1
160 0.1
161 0.1
162 0.09
163 0.1
164 0.11
165 0.18
166 0.27
167 0.35
168 0.44
169 0.52
170 0.61
171 0.69
172 0.77
173 0.81
174 0.83
175 0.85
176 0.87
177 0.87
178 0.84
179 0.85
180 0.82
181 0.78
182 0.73
183 0.66
184 0.57
185 0.5
186 0.43
187 0.34
188 0.29
189 0.22
190 0.17
191 0.16
192 0.15
193 0.15
194 0.16
195 0.18
196 0.23
197 0.23
198 0.22
199 0.2
200 0.22
201 0.21
202 0.24
203 0.25
204 0.24
205 0.25
206 0.24
207 0.24
208 0.21
209 0.25
210 0.2
211 0.22
212 0.21
213 0.23
214 0.25
215 0.27
216 0.27
217 0.22
218 0.25
219 0.22
220 0.19
221 0.15
222 0.13
223 0.11
224 0.12
225 0.13
226 0.1
227 0.07
228 0.08
229 0.07
230 0.07
231 0.06
232 0.06
233 0.06
234 0.06
235 0.08
236 0.08
237 0.08
238 0.08
239 0.11
240 0.11
241 0.16
242 0.19
243 0.17
244 0.16
245 0.21
246 0.22
247 0.23
248 0.23
249 0.21
250 0.19
251 0.21
252 0.22
253 0.2
254 0.18
255 0.17
256 0.25
257 0.23
258 0.29
259 0.3
260 0.3
261 0.37
262 0.41
263 0.43
264 0.35
265 0.36
266 0.3
267 0.36
268 0.36
269 0.28
270 0.26
271 0.23
272 0.23
273 0.29
274 0.32
275 0.25
276 0.31
277 0.32
278 0.34
279 0.38
280 0.4
281 0.39
282 0.4
283 0.43
284 0.43
285 0.5
286 0.51
287 0.52
288 0.57
289 0.56
290 0.55
291 0.55
292 0.55
293 0.55
294 0.53
295 0.55
296 0.53
297 0.52
298 0.5
299 0.55
300 0.55
301 0.5
302 0.53
303 0.5
304 0.48
305 0.47
306 0.47
307 0.42
308 0.44
309 0.45
310 0.42
311 0.47
312 0.45
313 0.46
314 0.48
315 0.51
316 0.5
317 0.53
318 0.57
319 0.52
320 0.59
321 0.64
322 0.6
323 0.58
324 0.58
325 0.5
326 0.48
327 0.52
328 0.47
329 0.44
330 0.45
331 0.42
332 0.41
333 0.43
334 0.47
335 0.42
336 0.42
337 0.4
338 0.48
339 0.55
340 0.52
341 0.51
342 0.47
343 0.53
344 0.6
345 0.6
346 0.52
347 0.47
348 0.53
349 0.6
350 0.6
351 0.52
352 0.47
353 0.53
354 0.6
355 0.6
356 0.52
357 0.48
358 0.52
359 0.59
360 0.59
361 0.5
362 0.46
363 0.51
364 0.52
365 0.52
366 0.46
367 0.39
368 0.36
369 0.39
370 0.36
371 0.32
372 0.3