Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XMX3

Protein Details
Accession A0A2B7XMX3   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-162REQIMQRKKLHNNENLPRVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
Amino Acid Sequences MVVKIRLSRFGNRHQPFYNIVVAQARSARDSKPLEVIGTYSPIPKIPTGLSEAEAKIAKPFKDIALDRSRTKYWLGVGAQPSEPVWRLLSLVCPTLWFFWHSSIILISAHDWLPHSLAKVLGWALGFEGWWASLNLDSAKCEREQIMQRKKLHNNENLPRVPDETFYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.53
4 0.5
5 0.46
6 0.35
7 0.33
8 0.3
9 0.28
10 0.27
11 0.26
12 0.23
13 0.2
14 0.22
15 0.21
16 0.24
17 0.27
18 0.27
19 0.29
20 0.29
21 0.27
22 0.25
23 0.26
24 0.19
25 0.19
26 0.17
27 0.14
28 0.13
29 0.14
30 0.15
31 0.13
32 0.14
33 0.12
34 0.13
35 0.16
36 0.16
37 0.17
38 0.18
39 0.17
40 0.18
41 0.18
42 0.16
43 0.16
44 0.19
45 0.18
46 0.17
47 0.18
48 0.16
49 0.22
50 0.23
51 0.26
52 0.31
53 0.34
54 0.34
55 0.37
56 0.37
57 0.31
58 0.31
59 0.26
60 0.19
61 0.21
62 0.2
63 0.21
64 0.22
65 0.22
66 0.21
67 0.2
68 0.19
69 0.14
70 0.13
71 0.1
72 0.09
73 0.07
74 0.07
75 0.07
76 0.1
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.1
83 0.11
84 0.1
85 0.09
86 0.1
87 0.12
88 0.12
89 0.11
90 0.11
91 0.11
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.1
101 0.1
102 0.11
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.07
114 0.05
115 0.06
116 0.04
117 0.05
118 0.06
119 0.06
120 0.06
121 0.08
122 0.1
123 0.11
124 0.12
125 0.13
126 0.15
127 0.15
128 0.16
129 0.17
130 0.22
131 0.32
132 0.41
133 0.5
134 0.56
135 0.63
136 0.71
137 0.78
138 0.8
139 0.79
140 0.78
141 0.78
142 0.79
143 0.81
144 0.76
145 0.7
146 0.63
147 0.56
148 0.48