Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MV82

Protein Details
Accession B8MV82    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-50SRPPRRGQSLKAERKRKRTAABasic
55-75LSEGPPPKRKREKNSVPSAAFHydrophilic
NLS Segment(s)
PositionSequence
27-67KVASRPPRRGQSLKAERKRKRTAAAAELLSEGPPPKRKREK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGFMEGGRYLPGDYVDEGKLLLFIKEKVASRPPRRGQSLKAERKRKRTAAAAELLSEGPPPKRKREKNSVPSAAFEELLVESDNDETCSEPVPMYNTVRSYCSAINELWAYQTSLGLHNAAHRLPKASTNADVMGSQTVGWLRYEMGTLPLRLLILQERSGPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.13
5 0.12
6 0.13
7 0.12
8 0.11
9 0.1
10 0.11
11 0.14
12 0.19
13 0.21
14 0.24
15 0.32
16 0.42
17 0.47
18 0.57
19 0.61
20 0.65
21 0.71
22 0.71
23 0.68
24 0.69
25 0.72
26 0.73
27 0.75
28 0.77
29 0.77
30 0.82
31 0.85
32 0.79
33 0.74
34 0.71
35 0.68
36 0.64
37 0.62
38 0.53
39 0.45
40 0.4
41 0.34
42 0.25
43 0.2
44 0.14
45 0.12
46 0.19
47 0.21
48 0.29
49 0.4
50 0.48
51 0.56
52 0.66
53 0.74
54 0.76
55 0.83
56 0.81
57 0.71
58 0.65
59 0.59
60 0.48
61 0.37
62 0.27
63 0.18
64 0.1
65 0.1
66 0.08
67 0.06
68 0.05
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.06
78 0.07
79 0.09
80 0.11
81 0.12
82 0.14
83 0.15
84 0.15
85 0.17
86 0.17
87 0.17
88 0.16
89 0.16
90 0.16
91 0.14
92 0.16
93 0.15
94 0.14
95 0.12
96 0.12
97 0.11
98 0.09
99 0.1
100 0.08
101 0.09
102 0.1
103 0.1
104 0.09
105 0.11
106 0.13
107 0.13
108 0.15
109 0.14
110 0.17
111 0.17
112 0.22
113 0.24
114 0.25
115 0.26
116 0.26
117 0.26
118 0.24
119 0.23
120 0.19
121 0.16
122 0.13
123 0.11
124 0.09
125 0.09
126 0.09
127 0.1
128 0.09
129 0.09
130 0.09
131 0.1
132 0.1
133 0.14
134 0.16
135 0.16
136 0.16
137 0.16
138 0.16
139 0.15
140 0.16
141 0.16
142 0.17
143 0.19
144 0.23