Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7WJ98

Protein Details
Accession A0A2B7WJ98    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
144-163RLVLWRERSHRKKLNKRLWEBasic
239-292ANSSERRSEKKSEKKSEKKSEKKSEKKSEKKSEKKSEKRSEKRSEKRSEKDDEGBasic
NLS Segment(s)
PositionSequence
151-171RSHRKKLNKRLWESAKESKKK
244-301RRSEKKSEKKSEKKSEKKSEKKSEKKSEKKSEKRSEKRSEKRSEKDDEGEIEKAKKKK
Subcellular Location(s) mito 20, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVSALLRRCLEPGLYPRSLVVRRLLGYHHRCSAAAVVANKFPPPSICRRLNSKAPAAESDHASTDSSEISAPAAPEGPPLASLLKRPYLHLANKRIGPAAEPKVPKNSPRVKNDFGSIVNKLLQVAEQGKPLTSVISSHEEWDRLVLWRERSHRKKLNKRLWESAKESKKKYDKMVAEKENAGRMSPINPDDLRMLQEMKTAWEHKEKEWTQFKADQRQRRISWQRLKTEWEAQQGGVANSSERRSEKKSEKKSEKKSEKKSEKKSEKKSEKKSEKRSEKRSEKRSEKDDEGEIEKAKKKKAVLSMGDDQEDAYNFAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.39
5 0.4
6 0.37
7 0.34
8 0.32
9 0.32
10 0.34
11 0.37
12 0.4
13 0.44
14 0.47
15 0.46
16 0.42
17 0.41
18 0.41
19 0.39
20 0.33
21 0.31
22 0.29
23 0.26
24 0.28
25 0.29
26 0.28
27 0.25
28 0.21
29 0.21
30 0.23
31 0.29
32 0.35
33 0.42
34 0.45
35 0.54
36 0.6
37 0.64
38 0.66
39 0.64
40 0.59
41 0.55
42 0.54
43 0.51
44 0.46
45 0.4
46 0.36
47 0.3
48 0.26
49 0.24
50 0.2
51 0.16
52 0.13
53 0.11
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.08
62 0.09
63 0.1
64 0.09
65 0.08
66 0.09
67 0.1
68 0.1
69 0.13
70 0.16
71 0.22
72 0.22
73 0.24
74 0.28
75 0.33
76 0.41
77 0.46
78 0.5
79 0.48
80 0.5
81 0.5
82 0.46
83 0.38
84 0.33
85 0.32
86 0.3
87 0.31
88 0.31
89 0.32
90 0.38
91 0.4
92 0.41
93 0.43
94 0.48
95 0.5
96 0.56
97 0.62
98 0.58
99 0.58
100 0.57
101 0.5
102 0.42
103 0.38
104 0.3
105 0.24
106 0.21
107 0.19
108 0.17
109 0.14
110 0.12
111 0.11
112 0.13
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.13
119 0.11
120 0.08
121 0.08
122 0.09
123 0.13
124 0.14
125 0.15
126 0.16
127 0.16
128 0.15
129 0.15
130 0.13
131 0.1
132 0.13
133 0.14
134 0.16
135 0.21
136 0.27
137 0.37
138 0.42
139 0.5
140 0.55
141 0.63
142 0.71
143 0.77
144 0.81
145 0.8
146 0.79
147 0.79
148 0.77
149 0.73
150 0.68
151 0.67
152 0.66
153 0.62
154 0.59
155 0.58
156 0.59
157 0.57
158 0.55
159 0.54
160 0.51
161 0.55
162 0.62
163 0.58
164 0.53
165 0.52
166 0.48
167 0.44
168 0.37
169 0.28
170 0.2
171 0.16
172 0.15
173 0.15
174 0.15
175 0.15
176 0.15
177 0.16
178 0.17
179 0.17
180 0.17
181 0.15
182 0.15
183 0.12
184 0.14
185 0.13
186 0.13
187 0.16
188 0.16
189 0.18
190 0.24
191 0.26
192 0.25
193 0.36
194 0.35
195 0.41
196 0.47
197 0.47
198 0.44
199 0.49
200 0.52
201 0.53
202 0.59
203 0.59
204 0.59
205 0.66
206 0.63
207 0.66
208 0.71
209 0.7
210 0.72
211 0.72
212 0.71
213 0.65
214 0.69
215 0.62
216 0.61
217 0.56
218 0.52
219 0.45
220 0.38
221 0.37
222 0.34
223 0.29
224 0.23
225 0.18
226 0.13
227 0.14
228 0.16
229 0.16
230 0.16
231 0.21
232 0.25
233 0.34
234 0.44
235 0.52
236 0.62
237 0.69
238 0.78
239 0.84
240 0.9
241 0.92
242 0.93
243 0.93
244 0.93
245 0.93
246 0.93
247 0.93
248 0.93
249 0.93
250 0.93
251 0.93
252 0.93
253 0.93
254 0.93
255 0.93
256 0.93
257 0.93
258 0.93
259 0.93
260 0.94
261 0.94
262 0.94
263 0.94
264 0.93
265 0.93
266 0.93
267 0.93
268 0.92
269 0.92
270 0.9
271 0.89
272 0.86
273 0.83
274 0.78
275 0.72
276 0.66
277 0.6
278 0.54
279 0.48
280 0.44
281 0.43
282 0.43
283 0.43
284 0.44
285 0.44
286 0.43
287 0.47
288 0.53
289 0.57
290 0.56
291 0.59
292 0.63
293 0.63
294 0.6
295 0.53
296 0.44
297 0.36
298 0.3