Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8M4Y3

Protein Details
Accession B8M4Y3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTTRKTKPRSEKRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
8-27TRKTKPRSEKRKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTTRKTKPRSEKRKKDPNAPKRGLSAYMFFANENRERVRDENPGIAFGALGRKLGELWKGLSDAERKPYEDKAAADKKRYEDQKASYLAGGDEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.92
5 0.95
6 0.91
7 0.9
8 0.9
9 0.89
10 0.89
11 0.82
12 0.74
13 0.68
14 0.63
15 0.56
16 0.46
17 0.38
18 0.3
19 0.27
20 0.25
21 0.2
22 0.19
23 0.2
24 0.2
25 0.21
26 0.19
27 0.18
28 0.2
29 0.22
30 0.25
31 0.26
32 0.25
33 0.27
34 0.26
35 0.26
36 0.23
37 0.21
38 0.16
39 0.11
40 0.12
41 0.07
42 0.07
43 0.06
44 0.06
45 0.07
46 0.08
47 0.1
48 0.08
49 0.09
50 0.1
51 0.1
52 0.1
53 0.13
54 0.16
55 0.16
56 0.22
57 0.22
58 0.23
59 0.25
60 0.28
61 0.29
62 0.29
63 0.29
64 0.32
65 0.4
66 0.42
67 0.45
68 0.47
69 0.47
70 0.53
71 0.56
72 0.53
73 0.51
74 0.52
75 0.54
76 0.53
77 0.5
78 0.42
79 0.38
80 0.31
81 0.25
82 0.2
83 0.14