Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WE14

Protein Details
Accession A0A2B7WE14   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-99HSSFNYRKRWWNGGKKSNGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 2, nucl 1, plas 1, pero 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASSNRLIPLLILLVVVGILAVVGFVTWSIMMAVKAQTKKEMEKKHVTMSRGGMKVGVKELNDEQYKDISQGILVNMWNHSSFNYRKRWWNGGKKSNGSGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.01
10 0.01
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.04
19 0.06
20 0.08
21 0.13
22 0.15
23 0.16
24 0.19
25 0.21
26 0.27
27 0.34
28 0.39
29 0.41
30 0.47
31 0.49
32 0.54
33 0.56
34 0.5
35 0.45
36 0.42
37 0.41
38 0.34
39 0.31
40 0.25
41 0.22
42 0.21
43 0.2
44 0.19
45 0.12
46 0.14
47 0.15
48 0.19
49 0.2
50 0.2
51 0.19
52 0.19
53 0.19
54 0.18
55 0.17
56 0.1
57 0.09
58 0.1
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.12
65 0.12
66 0.1
67 0.11
68 0.16
69 0.21
70 0.27
71 0.36
72 0.39
73 0.48
74 0.55
75 0.64
76 0.68
77 0.74
78 0.77
79 0.78
80 0.83
81 0.8