Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MPQ3

Protein Details
Accession B8MPQ3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MALKREKKRRIRKKPLSLDLPNEKEBasic
NLS Segment(s)
PositionSequence
4-15KREKKRRIRKKP
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MALKREKKRRIRKKPLSLDLPNEKEASPRTIATKEDQAAQENARKDDKRLQKQLLKEGREQEKQKRDQIRQQIREERAQQAAEKQRQKLEQKAVKEADLQLKKCPDYSEAPYEPNEPKFKEIESQTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.92
4 0.87
5 0.84
6 0.83
7 0.76
8 0.67
9 0.57
10 0.47
11 0.41
12 0.37
13 0.33
14 0.25
15 0.22
16 0.23
17 0.24
18 0.26
19 0.26
20 0.3
21 0.26
22 0.28
23 0.28
24 0.27
25 0.27
26 0.28
27 0.29
28 0.25
29 0.27
30 0.29
31 0.28
32 0.28
33 0.35
34 0.43
35 0.48
36 0.53
37 0.58
38 0.57
39 0.6
40 0.67
41 0.65
42 0.58
43 0.53
44 0.52
45 0.52
46 0.53
47 0.54
48 0.52
49 0.54
50 0.55
51 0.58
52 0.59
53 0.57
54 0.58
55 0.65
56 0.66
57 0.65
58 0.68
59 0.69
60 0.64
61 0.65
62 0.6
63 0.52
64 0.45
65 0.39
66 0.32
67 0.31
68 0.37
69 0.4
70 0.42
71 0.41
72 0.43
73 0.49
74 0.54
75 0.54
76 0.55
77 0.53
78 0.51
79 0.57
80 0.54
81 0.48
82 0.45
83 0.41
84 0.41
85 0.42
86 0.39
87 0.37
88 0.4
89 0.4
90 0.39
91 0.37
92 0.31
93 0.31
94 0.35
95 0.39
96 0.37
97 0.38
98 0.38
99 0.41
100 0.42
101 0.42
102 0.42
103 0.36
104 0.37
105 0.36
106 0.36
107 0.39