Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5X0I5

Protein Details
Accession A0A2C5X0I5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-121GSMQPCRQVRALRRNRNKAQDRIPHRVGHydrophilic
NLS Segment(s)
PositionSequence
107-124RNRNKAQDRIPHRVGKVP
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 8
Family & Domain DBs
Amino Acid Sequences MKEGALETIRNHLDASAIDKETDSQGAFSGELKILEFREYENETQVHSIRVAALNPERSPKTTNLLGNERVVKKIDSKPSPAQIHPALVKAQGGSMQPCRQVRALRRNRNKAQDRIPHRVGKVPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.18
4 0.18
5 0.18
6 0.17
7 0.19
8 0.19
9 0.2
10 0.15
11 0.1
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.11
21 0.1
22 0.11
23 0.11
24 0.1
25 0.14
26 0.17
27 0.17
28 0.19
29 0.18
30 0.18
31 0.2
32 0.2
33 0.16
34 0.12
35 0.12
36 0.1
37 0.1
38 0.1
39 0.11
40 0.13
41 0.15
42 0.15
43 0.19
44 0.19
45 0.19
46 0.22
47 0.2
48 0.22
49 0.24
50 0.25
51 0.26
52 0.29
53 0.29
54 0.28
55 0.32
56 0.28
57 0.26
58 0.25
59 0.21
60 0.23
61 0.27
62 0.34
63 0.31
64 0.37
65 0.4
66 0.48
67 0.51
68 0.46
69 0.45
70 0.38
71 0.38
72 0.33
73 0.3
74 0.23
75 0.2
76 0.2
77 0.14
78 0.13
79 0.12
80 0.12
81 0.14
82 0.18
83 0.21
84 0.27
85 0.28
86 0.3
87 0.32
88 0.38
89 0.44
90 0.5
91 0.58
92 0.63
93 0.73
94 0.81
95 0.85
96 0.89
97 0.88
98 0.86
99 0.85
100 0.84
101 0.81
102 0.8
103 0.79
104 0.75
105 0.68
106 0.68