Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5WYX7

Protein Details
Accession A0A2C5WYX7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPAAKKQKKKWSKGKVKDKAQHAVYHydrophilic
NLS Segment(s)
PositionSequence
5-20AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAKKQKKKWSKGKVKDKAQHAVYLEKNVSERLHKDVQSYRLVTVATLVDRMKINGSLARKCLKELEEEGLIKPVVQHSKMQIYTRVVSATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.93
5 0.9
6 0.86
7 0.83
8 0.74
9 0.67
10 0.58
11 0.55
12 0.46
13 0.43
14 0.36
15 0.28
16 0.27
17 0.24
18 0.23
19 0.2
20 0.2
21 0.21
22 0.25
23 0.25
24 0.28
25 0.31
26 0.34
27 0.35
28 0.35
29 0.29
30 0.25
31 0.24
32 0.2
33 0.16
34 0.12
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.12
45 0.16
46 0.16
47 0.2
48 0.24
49 0.23
50 0.24
51 0.27
52 0.24
53 0.25
54 0.25
55 0.26
56 0.26
57 0.27
58 0.26
59 0.25
60 0.24
61 0.19
62 0.17
63 0.19
64 0.19
65 0.2
66 0.22
67 0.24
68 0.33
69 0.37
70 0.39
71 0.4
72 0.4
73 0.4
74 0.4