Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5X184

Protein Details
Accession A0A2C5X184    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-142AAMHKEQKRRAGRPKTLFWPKHydrophilic
NLS Segment(s)
PositionSequence
129-136KRRAGRPK
Subcellular Location(s) nucl 16, mito 8.5, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MPARSLVASASQQMAEEGLLKETPDFIKLCMTPANLGVESVEYMRKASSNIRVIVDTANRQAMQVLDSETNKPLASQSTSIEMGVSSNGASKFAEDFGRRSDLPGLMSGNTMIDERNFLELAAMHKEQKRRAGRPKTLFWPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.1
3 0.12
4 0.1
5 0.1
6 0.1
7 0.11
8 0.1
9 0.13
10 0.13
11 0.13
12 0.13
13 0.12
14 0.17
15 0.17
16 0.19
17 0.2
18 0.2
19 0.18
20 0.19
21 0.22
22 0.17
23 0.17
24 0.15
25 0.12
26 0.11
27 0.11
28 0.11
29 0.07
30 0.08
31 0.08
32 0.08
33 0.09
34 0.13
35 0.19
36 0.23
37 0.25
38 0.26
39 0.26
40 0.26
41 0.27
42 0.25
43 0.19
44 0.16
45 0.16
46 0.14
47 0.14
48 0.14
49 0.12
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.11
56 0.11
57 0.12
58 0.11
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.13
66 0.13
67 0.13
68 0.12
69 0.1
70 0.09
71 0.08
72 0.07
73 0.04
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.09
80 0.1
81 0.14
82 0.12
83 0.14
84 0.16
85 0.21
86 0.2
87 0.21
88 0.22
89 0.2
90 0.19
91 0.2
92 0.18
93 0.15
94 0.15
95 0.13
96 0.11
97 0.1
98 0.09
99 0.08
100 0.07
101 0.08
102 0.09
103 0.11
104 0.11
105 0.1
106 0.11
107 0.12
108 0.14
109 0.18
110 0.18
111 0.21
112 0.25
113 0.31
114 0.36
115 0.44
116 0.51
117 0.55
118 0.64
119 0.71
120 0.77
121 0.8
122 0.83