Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5WUV7

Protein Details
Accession A0A2C5WUV7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-45PVDGNLPRAPPRRRSRPATRGPASKRQKRRFAIRERDELSHydrophilic
NLS Segment(s)
PositionSequence
13-37RAPPRRRSRPATRGPASKRQKRRFA
Subcellular Location(s) nucl 12, plas 9, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEQPGPVDGNLPRAPPRRRSRPATRGPASKRQKRRFAIRERDELSGPDSASDSESDSEEAIESNEGPGSGGGGAGNSAPPPANTLPPASTPSVQSSTTSTSTSRPTATPPPQTTPPPQTTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPAVAAPIVAPPPAEKPPPSASAASSHRGLVPVLLETQSTLSTTTRSTPPVRSEPPPAATTPARIIAEPQTRDPTSTPSSSSSSSSSSSRRSPLPTTTTTTTRPADAVLPGVPLITPLPEDIVAPGSSILPLTFSTVTNIQESLSATEAPVPEAPAVGNSTVNAGIGIGTVSGLAAIVGFIMILSRSYKQRSRLRGGSPGASMRNGSPLPTAKPGPLPGTFEPFKPIMLPPGMTFTVVPESKPPVPRAASPSAPPPAMVPSMNMSGSAGYDNPSATTSPENPFISPQELDYRSGAGNMSDVQMPQRMAGGTMRASSMYPDGANMYPPINAPLPDQVQEMGSASNYASYQPYQQQNQRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.63
4 0.67
5 0.74
6 0.8
7 0.83
8 0.85
9 0.89
10 0.89
11 0.87
12 0.86
13 0.84
14 0.86
15 0.85
16 0.85
17 0.85
18 0.85
19 0.87
20 0.86
21 0.89
22 0.89
23 0.89
24 0.9
25 0.87
26 0.86
27 0.79
28 0.74
29 0.64
30 0.55
31 0.47
32 0.39
33 0.31
34 0.22
35 0.19
36 0.16
37 0.16
38 0.15
39 0.15
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.05
64 0.06
65 0.06
66 0.07
67 0.12
68 0.14
69 0.16
70 0.17
71 0.2
72 0.21
73 0.23
74 0.27
75 0.24
76 0.24
77 0.23
78 0.27
79 0.27
80 0.26
81 0.24
82 0.24
83 0.26
84 0.26
85 0.25
86 0.22
87 0.21
88 0.25
89 0.27
90 0.26
91 0.22
92 0.25
93 0.33
94 0.39
95 0.46
96 0.46
97 0.49
98 0.52
99 0.56
100 0.57
101 0.56
102 0.54
103 0.5
104 0.48
105 0.48
106 0.49
107 0.48
108 0.43
109 0.38
110 0.32
111 0.28
112 0.26
113 0.21
114 0.16
115 0.14
116 0.12
117 0.09
118 0.09
119 0.09
120 0.13
121 0.15
122 0.17
123 0.16
124 0.21
125 0.25
126 0.28
127 0.3
128 0.27
129 0.25
130 0.29
131 0.32
132 0.3
133 0.27
134 0.24
135 0.22
136 0.21
137 0.2
138 0.14
139 0.11
140 0.09
141 0.09
142 0.09
143 0.08
144 0.08
145 0.09
146 0.08
147 0.08
148 0.08
149 0.07
150 0.08
151 0.09
152 0.12
153 0.14
154 0.18
155 0.21
156 0.24
157 0.29
158 0.35
159 0.39
160 0.39
161 0.41
162 0.41
163 0.41
164 0.38
165 0.33
166 0.3
167 0.27
168 0.25
169 0.22
170 0.22
171 0.19
172 0.17
173 0.18
174 0.21
175 0.27
176 0.27
177 0.27
178 0.29
179 0.28
180 0.3
181 0.29
182 0.27
183 0.24
184 0.24
185 0.24
186 0.21
187 0.24
188 0.23
189 0.24
190 0.2
191 0.19
192 0.19
193 0.2
194 0.2
195 0.21
196 0.23
197 0.24
198 0.25
199 0.27
200 0.28
201 0.31
202 0.33
203 0.32
204 0.34
205 0.34
206 0.35
207 0.33
208 0.34
209 0.3
210 0.25
211 0.22
212 0.18
213 0.17
214 0.14
215 0.13
216 0.09
217 0.08
218 0.07
219 0.07
220 0.06
221 0.05
222 0.05
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.04
239 0.04
240 0.07
241 0.07
242 0.07
243 0.09
244 0.11
245 0.12
246 0.12
247 0.12
248 0.1
249 0.1
250 0.11
251 0.1
252 0.09
253 0.08
254 0.07
255 0.1
256 0.1
257 0.1
258 0.09
259 0.09
260 0.08
261 0.08
262 0.08
263 0.06
264 0.07
265 0.07
266 0.06
267 0.06
268 0.07
269 0.07
270 0.07
271 0.06
272 0.05
273 0.04
274 0.04
275 0.04
276 0.03
277 0.03
278 0.03
279 0.02
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.03
292 0.05
293 0.07
294 0.1
295 0.15
296 0.2
297 0.29
298 0.37
299 0.44
300 0.51
301 0.56
302 0.57
303 0.61
304 0.6
305 0.53
306 0.48
307 0.43
308 0.37
309 0.3
310 0.27
311 0.19
312 0.21
313 0.18
314 0.17
315 0.17
316 0.18
317 0.2
318 0.24
319 0.24
320 0.21
321 0.23
322 0.25
323 0.25
324 0.24
325 0.27
326 0.24
327 0.3
328 0.3
329 0.28
330 0.29
331 0.25
332 0.24
333 0.2
334 0.19
335 0.17
336 0.17
337 0.18
338 0.15
339 0.19
340 0.19
341 0.18
342 0.17
343 0.14
344 0.2
345 0.19
346 0.19
347 0.17
348 0.22
349 0.27
350 0.31
351 0.32
352 0.31
353 0.33
354 0.37
355 0.41
356 0.41
357 0.39
358 0.37
359 0.41
360 0.38
361 0.36
362 0.32
363 0.26
364 0.23
365 0.23
366 0.21
367 0.17
368 0.16
369 0.18
370 0.18
371 0.17
372 0.14
373 0.12
374 0.12
375 0.12
376 0.09
377 0.08
378 0.09
379 0.09
380 0.1
381 0.11
382 0.1
383 0.11
384 0.15
385 0.17
386 0.2
387 0.26
388 0.27
389 0.26
390 0.29
391 0.3
392 0.3
393 0.26
394 0.25
395 0.27
396 0.28
397 0.29
398 0.27
399 0.27
400 0.23
401 0.24
402 0.22
403 0.13
404 0.13
405 0.12
406 0.12
407 0.11
408 0.12
409 0.13
410 0.16
411 0.16
412 0.15
413 0.16
414 0.15
415 0.15
416 0.16
417 0.18
418 0.16
419 0.16
420 0.17
421 0.15
422 0.15
423 0.16
424 0.16
425 0.14
426 0.13
427 0.13
428 0.15
429 0.15
430 0.17
431 0.16
432 0.15
433 0.14
434 0.15
435 0.18
436 0.17
437 0.17
438 0.18
439 0.23
440 0.26
441 0.26
442 0.27
443 0.24
444 0.22
445 0.22
446 0.21
447 0.15
448 0.12
449 0.11
450 0.1
451 0.11
452 0.11
453 0.12
454 0.13
455 0.14
456 0.19
457 0.27
458 0.35
459 0.41