Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MVC5

Protein Details
Accession B8MVC5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32MIRRHRFNSWTVRKERKANAKRWHARLGHHydrophilic
NLS Segment(s)
PositionSequence
16-34RKERKANAKRWHARLGHPR
Subcellular Location(s) nucl 16.5, mito_nucl 13.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MAFMIRRHRFNSWTVRKERKANAKRWHARLGHPRPQAIKHLATMTKGVLPLYSAKPMEGQKPDELYNKKKEILWNDLAWGVIKDKARAIRNDAKLPMDLWSEIYQASIYLYNCTPKFMYNWKTLYDSYKAYTLTSEYQLKKNRLQCFNLRAWVDYLVGYDSTNVYRIWNPSTGRIVRARDVIFNKDEVFSEDIQDIKDDLLHVSVEELTILLNKIDIQVQSGEVKDNANFRDKMEDLVFDRNRHNDERTTTTGSVTGSGFEDSSQLDSDYPSGPSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.75
4 0.81
5 0.82
6 0.82
7 0.81
8 0.82
9 0.83
10 0.84
11 0.86
12 0.84
13 0.84
14 0.77
15 0.76
16 0.78
17 0.77
18 0.75
19 0.71
20 0.7
21 0.65
22 0.65
23 0.63
24 0.58
25 0.51
26 0.44
27 0.45
28 0.42
29 0.38
30 0.36
31 0.3
32 0.26
33 0.24
34 0.21
35 0.14
36 0.14
37 0.17
38 0.18
39 0.21
40 0.19
41 0.19
42 0.23
43 0.26
44 0.31
45 0.31
46 0.32
47 0.31
48 0.34
49 0.37
50 0.4
51 0.44
52 0.44
53 0.48
54 0.48
55 0.46
56 0.46
57 0.49
58 0.47
59 0.49
60 0.46
61 0.38
62 0.36
63 0.34
64 0.32
65 0.26
66 0.21
67 0.14
68 0.13
69 0.14
70 0.13
71 0.16
72 0.22
73 0.26
74 0.28
75 0.35
76 0.4
77 0.44
78 0.48
79 0.46
80 0.41
81 0.37
82 0.36
83 0.3
84 0.22
85 0.17
86 0.14
87 0.14
88 0.13
89 0.12
90 0.12
91 0.09
92 0.08
93 0.08
94 0.09
95 0.08
96 0.09
97 0.1
98 0.15
99 0.15
100 0.16
101 0.16
102 0.14
103 0.17
104 0.22
105 0.27
106 0.28
107 0.3
108 0.3
109 0.32
110 0.32
111 0.33
112 0.28
113 0.24
114 0.2
115 0.2
116 0.19
117 0.16
118 0.15
119 0.14
120 0.13
121 0.15
122 0.2
123 0.2
124 0.26
125 0.32
126 0.35
127 0.39
128 0.44
129 0.48
130 0.47
131 0.49
132 0.49
133 0.48
134 0.48
135 0.47
136 0.41
137 0.34
138 0.3
139 0.27
140 0.21
141 0.15
142 0.13
143 0.09
144 0.08
145 0.07
146 0.07
147 0.06
148 0.06
149 0.07
150 0.07
151 0.08
152 0.1
153 0.12
154 0.14
155 0.18
156 0.18
157 0.2
158 0.27
159 0.26
160 0.28
161 0.31
162 0.31
163 0.29
164 0.33
165 0.3
166 0.3
167 0.31
168 0.32
169 0.28
170 0.27
171 0.26
172 0.22
173 0.21
174 0.18
175 0.18
176 0.14
177 0.14
178 0.14
179 0.13
180 0.13
181 0.13
182 0.11
183 0.08
184 0.08
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.07
191 0.07
192 0.06
193 0.06
194 0.05
195 0.04
196 0.05
197 0.06
198 0.05
199 0.05
200 0.05
201 0.06
202 0.09
203 0.09
204 0.1
205 0.1
206 0.12
207 0.14
208 0.14
209 0.15
210 0.13
211 0.15
212 0.15
213 0.19
214 0.2
215 0.24
216 0.24
217 0.24
218 0.3
219 0.29
220 0.31
221 0.28
222 0.29
223 0.26
224 0.35
225 0.38
226 0.33
227 0.37
228 0.38
229 0.41
230 0.42
231 0.43
232 0.39
233 0.41
234 0.46
235 0.47
236 0.49
237 0.45
238 0.42
239 0.4
240 0.34
241 0.31
242 0.24
243 0.19
244 0.14
245 0.14
246 0.13
247 0.11
248 0.12
249 0.1
250 0.12
251 0.12
252 0.11
253 0.11
254 0.12
255 0.14
256 0.14
257 0.15