Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XBH0

Protein Details
Accession A0A2C5XBH0   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
137-160GDDSRSSKKSKPKKRTRGLNDSESHydrophilic
206-226FMKTPPPDSKKREQEWRKLTEHydrophilic
NLS Segment(s)
PositionSequence
143-153SKKSKPKKRTR
Subcellular Location(s) nucl 24, mito_nucl 13.333, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MSRLRHSWNSDNAPTGPVNISTKDYSYITPEDIGKDNLFWQSPDSYNSSETADDVIYLVYEDKKLRTCFPPYSIADGKVCVRDLRTRAGLLFNITGKPLQTANLKYKGQPLRGEDHVVRQFNVKNKSEITICLSESGDDSRSSKKSKPKKRTRGLNDSESADQAGTSSSSRPETKPAYTKGATPMEQINIIEKWFDTEMLDMCQVFMKTPPPDSKKREQEWRKLTETTMQHVTLKLDAVEANGDQDVRNRRKEVCKRIEGIMKMLDEAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.29
4 0.24
5 0.25
6 0.22
7 0.25
8 0.24
9 0.25
10 0.25
11 0.25
12 0.23
13 0.25
14 0.25
15 0.22
16 0.23
17 0.23
18 0.23
19 0.25
20 0.26
21 0.22
22 0.21
23 0.21
24 0.22
25 0.21
26 0.18
27 0.18
28 0.19
29 0.2
30 0.22
31 0.24
32 0.23
33 0.23
34 0.24
35 0.23
36 0.19
37 0.18
38 0.16
39 0.12
40 0.1
41 0.09
42 0.08
43 0.06
44 0.06
45 0.07
46 0.07
47 0.09
48 0.1
49 0.13
50 0.19
51 0.21
52 0.25
53 0.29
54 0.34
55 0.36
56 0.39
57 0.44
58 0.4
59 0.46
60 0.44
61 0.41
62 0.35
63 0.33
64 0.31
65 0.25
66 0.24
67 0.17
68 0.17
69 0.21
70 0.23
71 0.26
72 0.26
73 0.25
74 0.25
75 0.27
76 0.25
77 0.21
78 0.2
79 0.16
80 0.14
81 0.14
82 0.14
83 0.11
84 0.12
85 0.1
86 0.11
87 0.15
88 0.18
89 0.24
90 0.31
91 0.31
92 0.31
93 0.39
94 0.41
95 0.41
96 0.41
97 0.38
98 0.35
99 0.37
100 0.4
101 0.31
102 0.34
103 0.35
104 0.32
105 0.29
106 0.27
107 0.29
108 0.31
109 0.37
110 0.31
111 0.28
112 0.28
113 0.29
114 0.27
115 0.25
116 0.23
117 0.18
118 0.17
119 0.16
120 0.15
121 0.13
122 0.13
123 0.13
124 0.1
125 0.09
126 0.1
127 0.12
128 0.15
129 0.18
130 0.23
131 0.31
132 0.4
133 0.51
134 0.6
135 0.68
136 0.76
137 0.83
138 0.88
139 0.88
140 0.89
141 0.84
142 0.79
143 0.7
144 0.62
145 0.53
146 0.43
147 0.34
148 0.23
149 0.16
150 0.1
151 0.08
152 0.06
153 0.06
154 0.06
155 0.07
156 0.11
157 0.13
158 0.14
159 0.19
160 0.22
161 0.27
162 0.33
163 0.35
164 0.38
165 0.37
166 0.38
167 0.4
168 0.41
169 0.36
170 0.32
171 0.3
172 0.25
173 0.25
174 0.23
175 0.19
176 0.15
177 0.14
178 0.12
179 0.1
180 0.11
181 0.11
182 0.11
183 0.09
184 0.09
185 0.1
186 0.12
187 0.13
188 0.1
189 0.1
190 0.12
191 0.12
192 0.11
193 0.11
194 0.15
195 0.16
196 0.22
197 0.3
198 0.35
199 0.44
200 0.51
201 0.6
202 0.64
203 0.7
204 0.76
205 0.76
206 0.8
207 0.8
208 0.8
209 0.74
210 0.66
211 0.6
212 0.57
213 0.51
214 0.46
215 0.41
216 0.36
217 0.33
218 0.33
219 0.33
220 0.26
221 0.23
222 0.18
223 0.14
224 0.13
225 0.12
226 0.12
227 0.11
228 0.11
229 0.11
230 0.11
231 0.1
232 0.16
233 0.26
234 0.3
235 0.36
236 0.38
237 0.44
238 0.55
239 0.65
240 0.7
241 0.7
242 0.73
243 0.7
244 0.74
245 0.76
246 0.67
247 0.61
248 0.55
249 0.45
250 0.38