Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5WX27

Protein Details
Accession A0A2C5WX27    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-28TEFRRDPPYPRKIARRISNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 10.666, cyto_nucl 6.833, cyto 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MKKEGNSVTEFRRDPPYPRKIARRISNLALEKPVGKVHWVPGHCEVPANEAIDQLAKAVCKSEDLLVPKATMSLTSVRRWRNEAFKANFRTWMKENCPKIKHLGGALNWPRPYDIGWMKGLHRGTVARILVARSGHGDFKEYHVRPNHTNAEIRCPVAGCDQAKNFTHPWECLGNEKNLSMTFVRKLLTGDKSCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.57
4 0.58
5 0.64
6 0.71
7 0.72
8 0.79
9 0.8
10 0.79
11 0.75
12 0.71
13 0.72
14 0.66
15 0.59
16 0.52
17 0.43
18 0.36
19 0.31
20 0.29
21 0.2
22 0.19
23 0.18
24 0.22
25 0.28
26 0.27
27 0.3
28 0.34
29 0.35
30 0.32
31 0.33
32 0.27
33 0.24
34 0.26
35 0.23
36 0.17
37 0.15
38 0.16
39 0.14
40 0.13
41 0.1
42 0.08
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.1
49 0.11
50 0.14
51 0.18
52 0.21
53 0.2
54 0.2
55 0.19
56 0.18
57 0.16
58 0.12
59 0.1
60 0.13
61 0.15
62 0.19
63 0.25
64 0.28
65 0.3
66 0.34
67 0.36
68 0.38
69 0.42
70 0.47
71 0.46
72 0.5
73 0.54
74 0.5
75 0.54
76 0.47
77 0.44
78 0.38
79 0.39
80 0.38
81 0.4
82 0.46
83 0.46
84 0.47
85 0.44
86 0.45
87 0.41
88 0.36
89 0.31
90 0.29
91 0.22
92 0.3
93 0.32
94 0.33
95 0.31
96 0.29
97 0.27
98 0.23
99 0.23
100 0.2
101 0.19
102 0.17
103 0.19
104 0.2
105 0.21
106 0.25
107 0.24
108 0.18
109 0.17
110 0.15
111 0.14
112 0.19
113 0.18
114 0.14
115 0.15
116 0.15
117 0.16
118 0.16
119 0.15
120 0.11
121 0.13
122 0.14
123 0.13
124 0.15
125 0.14
126 0.19
127 0.28
128 0.26
129 0.31
130 0.36
131 0.4
132 0.41
133 0.48
134 0.49
135 0.42
136 0.47
137 0.42
138 0.44
139 0.42
140 0.4
141 0.33
142 0.28
143 0.26
144 0.24
145 0.28
146 0.21
147 0.25
148 0.26
149 0.31
150 0.32
151 0.35
152 0.33
153 0.33
154 0.35
155 0.3
156 0.31
157 0.3
158 0.3
159 0.33
160 0.36
161 0.35
162 0.33
163 0.32
164 0.31
165 0.27
166 0.29
167 0.24
168 0.24
169 0.21
170 0.22
171 0.22
172 0.21
173 0.23
174 0.26
175 0.34