Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XAX2

Protein Details
Accession A0A2C5XAX2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRNKKSREKRREEKHQQRQHMLQQLQHydrophilic
NLS Segment(s)
PositionSequence
4-13NKKSREKRRE
Subcellular Location(s) mito 11, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MGRNKKSREKRREEKHQQRQHMLQQLQDVLGLTHPEFQSFDSLPQINRPKEECPVLVSIDFELWEVNGSTITEIGLAVLDPLLLRGLAPGDRGANWWSLVYAKHIWIKECQHMVNREYVSGCPESFNFGKTDIIPQRIKLELTKSFLEEILVPRRPLYVVGHDVGQDIQSFDNMGLMLESLTSELTLIDSREIYTLLANTLQGPSLGSALTGLNMDSRNLHNAGNDAVYTLRACLALALILKESDPQAYKTRELLDWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.94
4 0.92
5 0.9
6 0.87
7 0.84
8 0.83
9 0.73
10 0.65
11 0.59
12 0.52
13 0.43
14 0.36
15 0.27
16 0.18
17 0.17
18 0.16
19 0.11
20 0.15
21 0.15
22 0.15
23 0.16
24 0.16
25 0.2
26 0.19
27 0.2
28 0.19
29 0.22
30 0.21
31 0.29
32 0.37
33 0.34
34 0.38
35 0.39
36 0.37
37 0.4
38 0.43
39 0.35
40 0.3
41 0.3
42 0.28
43 0.25
44 0.23
45 0.18
46 0.15
47 0.14
48 0.1
49 0.08
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.08
79 0.09
80 0.1
81 0.1
82 0.1
83 0.1
84 0.09
85 0.09
86 0.1
87 0.12
88 0.12
89 0.13
90 0.17
91 0.18
92 0.19
93 0.23
94 0.26
95 0.27
96 0.29
97 0.28
98 0.28
99 0.31
100 0.31
101 0.32
102 0.29
103 0.25
104 0.23
105 0.21
106 0.19
107 0.17
108 0.15
109 0.11
110 0.1
111 0.14
112 0.13
113 0.14
114 0.12
115 0.11
116 0.12
117 0.11
118 0.18
119 0.17
120 0.22
121 0.22
122 0.22
123 0.23
124 0.23
125 0.24
126 0.18
127 0.2
128 0.19
129 0.22
130 0.22
131 0.2
132 0.2
133 0.19
134 0.18
135 0.15
136 0.15
137 0.18
138 0.2
139 0.19
140 0.18
141 0.19
142 0.18
143 0.19
144 0.18
145 0.16
146 0.17
147 0.17
148 0.18
149 0.17
150 0.18
151 0.16
152 0.14
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.06
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.09
188 0.08
189 0.07
190 0.08
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.07
198 0.06
199 0.06
200 0.08
201 0.09
202 0.09
203 0.11
204 0.13
205 0.16
206 0.18
207 0.18
208 0.16
209 0.17
210 0.18
211 0.17
212 0.15
213 0.12
214 0.11
215 0.11
216 0.11
217 0.1
218 0.09
219 0.08
220 0.08
221 0.07
222 0.08
223 0.09
224 0.1
225 0.1
226 0.1
227 0.11
228 0.11
229 0.12
230 0.13
231 0.15
232 0.16
233 0.19
234 0.26
235 0.3
236 0.32
237 0.35
238 0.38