Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5X7G2

Protein Details
Accession A0A2C5X7G2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-44GALRLKGAKVDKNKKKKKKRDKRLEVALERSSBasic
NLS Segment(s)
PositionSequence
16-35RLKGAKVDKNKKKKKKRDKR
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPLDDYTAVSGGGALRLKGAKVDKNKKKKKKRDKRLEVALERSSAASGEDDGVRDGSAKDKVDSKRRKASGSGDEGSAHESDNDEGTSFKTEAQRRFEEAKRKKFLELSKTASSNPELLKTHKERVEELNHFLSKLSEHNDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.13
5 0.17
6 0.22
7 0.25
8 0.35
9 0.47
10 0.55
11 0.65
12 0.76
13 0.83
14 0.89
15 0.93
16 0.94
17 0.94
18 0.95
19 0.96
20 0.96
21 0.95
22 0.95
23 0.94
24 0.88
25 0.82
26 0.73
27 0.62
28 0.51
29 0.41
30 0.3
31 0.2
32 0.15
33 0.09
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.11
45 0.12
46 0.12
47 0.19
48 0.24
49 0.34
50 0.42
51 0.46
52 0.52
53 0.54
54 0.55
55 0.51
56 0.53
57 0.49
58 0.47
59 0.41
60 0.32
61 0.31
62 0.29
63 0.27
64 0.21
65 0.14
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.05
72 0.06
73 0.06
74 0.09
75 0.09
76 0.11
77 0.17
78 0.22
79 0.27
80 0.33
81 0.35
82 0.37
83 0.42
84 0.46
85 0.5
86 0.54
87 0.59
88 0.6
89 0.59
90 0.57
91 0.58
92 0.59
93 0.57
94 0.54
95 0.51
96 0.49
97 0.49
98 0.47
99 0.44
100 0.38
101 0.33
102 0.28
103 0.26
104 0.23
105 0.25
106 0.33
107 0.36
108 0.43
109 0.42
110 0.43
111 0.4
112 0.45
113 0.52
114 0.47
115 0.47
116 0.47
117 0.44
118 0.42
119 0.39
120 0.33
121 0.25
122 0.25
123 0.24
124 0.22
125 0.23
126 0.29
127 0.33
128 0.34