Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5X0E5

Protein Details
Accession A0A2C5X0E5   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
380-408SWRNSNQDPRLRSRRVRRMAKMNTRKAMQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGLQTQTNHNQSQQPSPFAPQSRTSSIAQQSQSQSSAQSHTGYPSPHSIASVYPQSASSTTATTQQQDASQLPHYYSHATTSPYNSSQSTTGYPSTDTNEMMAATQMPRHPYPSMSYHQPQGSAPNSVAPSPQHDQHRSIYGQAPTQAMQQPMYYPPQQQYQPMPSQAPPAYGHHTAHTAQHPQHQQQPHQQPMSSQPAMMMSHAAPHNPMAQHTQPMVSNSPRNPKMELQTHQMQPKSAPSAGMSSAHSSGSVTPLTPTGSTPQAVNPNAAPGPIPATTPLVVRQDQNGVQWIAFEYSRDRVKMEYTIRCDVESVNTEELSQDFKTENCVYPRACCPKEQYRGNRQVYETECNTVGWALAQLNPTLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKMNTRKAMQTHAQAQVQVGHLSAGHMPPHSMDVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.48
4 0.52
5 0.5
6 0.51
7 0.47
8 0.49
9 0.49
10 0.5
11 0.46
12 0.47
13 0.48
14 0.51
15 0.46
16 0.46
17 0.45
18 0.45
19 0.45
20 0.37
21 0.34
22 0.3
23 0.31
24 0.27
25 0.25
26 0.22
27 0.24
28 0.27
29 0.25
30 0.25
31 0.27
32 0.28
33 0.26
34 0.26
35 0.23
36 0.21
37 0.25
38 0.27
39 0.23
40 0.2
41 0.21
42 0.22
43 0.21
44 0.22
45 0.18
46 0.15
47 0.15
48 0.21
49 0.22
50 0.22
51 0.23
52 0.23
53 0.23
54 0.24
55 0.25
56 0.21
57 0.24
58 0.23
59 0.22
60 0.23
61 0.23
62 0.23
63 0.22
64 0.22
65 0.2
66 0.22
67 0.23
68 0.26
69 0.29
70 0.28
71 0.3
72 0.27
73 0.27
74 0.25
75 0.26
76 0.24
77 0.22
78 0.22
79 0.2
80 0.21
81 0.2
82 0.23
83 0.22
84 0.2
85 0.16
86 0.15
87 0.14
88 0.13
89 0.12
90 0.1
91 0.08
92 0.11
93 0.13
94 0.17
95 0.17
96 0.2
97 0.21
98 0.21
99 0.25
100 0.27
101 0.3
102 0.33
103 0.35
104 0.37
105 0.37
106 0.37
107 0.33
108 0.33
109 0.31
110 0.25
111 0.23
112 0.22
113 0.22
114 0.21
115 0.22
116 0.16
117 0.2
118 0.21
119 0.26
120 0.29
121 0.32
122 0.35
123 0.36
124 0.41
125 0.35
126 0.36
127 0.36
128 0.3
129 0.29
130 0.28
131 0.26
132 0.21
133 0.24
134 0.25
135 0.2
136 0.19
137 0.17
138 0.17
139 0.18
140 0.21
141 0.19
142 0.18
143 0.2
144 0.24
145 0.25
146 0.27
147 0.3
148 0.32
149 0.33
150 0.34
151 0.34
152 0.29
153 0.33
154 0.3
155 0.28
156 0.24
157 0.23
158 0.26
159 0.26
160 0.26
161 0.21
162 0.23
163 0.21
164 0.23
165 0.23
166 0.23
167 0.22
168 0.28
169 0.31
170 0.31
171 0.37
172 0.38
173 0.39
174 0.44
175 0.51
176 0.5
177 0.48
178 0.46
179 0.4
180 0.42
181 0.46
182 0.36
183 0.28
184 0.21
185 0.22
186 0.22
187 0.21
188 0.16
189 0.08
190 0.11
191 0.12
192 0.11
193 0.1
194 0.1
195 0.13
196 0.12
197 0.13
198 0.13
199 0.14
200 0.16
201 0.16
202 0.16
203 0.14
204 0.16
205 0.17
206 0.16
207 0.19
208 0.2
209 0.29
210 0.3
211 0.31
212 0.32
213 0.33
214 0.36
215 0.39
216 0.38
217 0.36
218 0.4
219 0.42
220 0.43
221 0.4
222 0.35
223 0.29
224 0.29
225 0.27
226 0.21
227 0.17
228 0.14
229 0.15
230 0.16
231 0.16
232 0.14
233 0.12
234 0.13
235 0.12
236 0.11
237 0.1
238 0.09
239 0.1
240 0.09
241 0.07
242 0.07
243 0.08
244 0.09
245 0.09
246 0.09
247 0.1
248 0.11
249 0.11
250 0.12
251 0.14
252 0.2
253 0.2
254 0.21
255 0.18
256 0.19
257 0.19
258 0.19
259 0.15
260 0.09
261 0.11
262 0.11
263 0.11
264 0.09
265 0.11
266 0.12
267 0.12
268 0.15
269 0.16
270 0.17
271 0.17
272 0.18
273 0.2
274 0.21
275 0.21
276 0.22
277 0.18
278 0.17
279 0.16
280 0.15
281 0.13
282 0.12
283 0.11
284 0.1
285 0.14
286 0.17
287 0.17
288 0.17
289 0.17
290 0.19
291 0.25
292 0.3
293 0.32
294 0.35
295 0.4
296 0.4
297 0.39
298 0.38
299 0.31
300 0.28
301 0.25
302 0.23
303 0.19
304 0.18
305 0.18
306 0.18
307 0.18
308 0.17
309 0.14
310 0.11
311 0.1
312 0.1
313 0.17
314 0.19
315 0.23
316 0.23
317 0.28
318 0.27
319 0.31
320 0.4
321 0.43
322 0.41
323 0.4
324 0.45
325 0.5
326 0.59
327 0.65
328 0.66
329 0.67
330 0.76
331 0.79
332 0.76
333 0.67
334 0.65
335 0.6
336 0.58
337 0.49
338 0.41
339 0.36
340 0.31
341 0.3
342 0.22
343 0.18
344 0.11
345 0.11
346 0.09
347 0.11
348 0.12
349 0.13
350 0.14
351 0.18
352 0.21
353 0.22
354 0.22
355 0.24
356 0.25
357 0.31
358 0.39
359 0.44
360 0.46
361 0.47
362 0.48
363 0.49
364 0.53
365 0.51
366 0.45
367 0.42
368 0.44
369 0.46
370 0.45
371 0.48
372 0.51
373 0.54
374 0.57
375 0.61
376 0.64
377 0.67
378 0.75
379 0.78
380 0.8
381 0.82
382 0.86
383 0.85
384 0.86
385 0.89
386 0.91
387 0.9
388 0.89
389 0.86
390 0.79
391 0.74
392 0.66
393 0.63
394 0.58
395 0.55
396 0.53
397 0.53
398 0.52
399 0.48
400 0.47
401 0.43
402 0.39
403 0.31
404 0.23
405 0.17
406 0.14
407 0.15
408 0.17
409 0.15
410 0.15
411 0.15
412 0.15
413 0.16