Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5WXD1

Protein Details
Accession A0A2C5WXD1   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
214-235VPSKSRKAPEPEKKTRKPPPSTBasic
340-362EEERERARKAEKERRKRETLRRRBasic
NLS Segment(s)
PositionSequence
163-170KGLSKKER
186-190AKKMA
208-233RKATPAVPSKSRKAPEPEKKTRKPPP
343-362RERARKAEKERRKRETLRRR
Subcellular Location(s) nucl 15.5, mito_nucl 13.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSSIGNLLAQISGGSSSQAPPSRTNGTSQPERRVEPKMSTTASRPTSRPPIGANSFKSAPVSSSRPVQQRPTPSARPIPSRPPPRPEQVTRPATTARNGVTKPSSGFAQTSSSALKPTPRPVQLTSSSAPPRKGSYAEIMARAQRAQEVMGQVGKIQHKKVEKGLSKKERTEQMERLKSEQKATSAKKMAASRTSKARGGTVTDVNNRKATPAVPSKSRKAPEPEKKTRKPPPSTGYTGTARPSAPSKLKKHTPGGALLETSSYSRSSSAARYEEEDEDMDGFIDDEEEEDPEDNIRYGRRYVYDDYDSDGSSDMEVGLNEIDHEEAIAERIARQDDRLEEERERARKAEKERRKRETLRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.17
5 0.22
6 0.24
7 0.26
8 0.32
9 0.37
10 0.37
11 0.4
12 0.41
13 0.43
14 0.51
15 0.54
16 0.58
17 0.56
18 0.59
19 0.59
20 0.58
21 0.55
22 0.51
23 0.51
24 0.48
25 0.46
26 0.46
27 0.45
28 0.47
29 0.49
30 0.47
31 0.43
32 0.44
33 0.51
34 0.5
35 0.49
36 0.44
37 0.46
38 0.49
39 0.54
40 0.5
41 0.46
42 0.45
43 0.43
44 0.42
45 0.33
46 0.28
47 0.26
48 0.27
49 0.23
50 0.29
51 0.34
52 0.4
53 0.44
54 0.49
55 0.5
56 0.54
57 0.6
58 0.62
59 0.6
60 0.59
61 0.63
62 0.61
63 0.62
64 0.59
65 0.61
66 0.63
67 0.67
68 0.68
69 0.66
70 0.67
71 0.68
72 0.71
73 0.67
74 0.67
75 0.67
76 0.68
77 0.62
78 0.59
79 0.55
80 0.49
81 0.45
82 0.39
83 0.31
84 0.3
85 0.29
86 0.3
87 0.28
88 0.28
89 0.27
90 0.24
91 0.23
92 0.18
93 0.18
94 0.15
95 0.17
96 0.15
97 0.15
98 0.16
99 0.15
100 0.15
101 0.15
102 0.19
103 0.19
104 0.25
105 0.31
106 0.32
107 0.36
108 0.37
109 0.43
110 0.41
111 0.42
112 0.36
113 0.36
114 0.39
115 0.39
116 0.38
117 0.33
118 0.32
119 0.3
120 0.3
121 0.25
122 0.24
123 0.27
124 0.27
125 0.28
126 0.27
127 0.26
128 0.25
129 0.23
130 0.19
131 0.13
132 0.11
133 0.1
134 0.1
135 0.1
136 0.1
137 0.11
138 0.1
139 0.1
140 0.14
141 0.18
142 0.18
143 0.18
144 0.22
145 0.24
146 0.26
147 0.31
148 0.37
149 0.39
150 0.44
151 0.54
152 0.59
153 0.6
154 0.61
155 0.6
156 0.58
157 0.58
158 0.56
159 0.54
160 0.54
161 0.56
162 0.54
163 0.53
164 0.51
165 0.47
166 0.43
167 0.37
168 0.31
169 0.32
170 0.33
171 0.36
172 0.34
173 0.34
174 0.35
175 0.36
176 0.35
177 0.35
178 0.37
179 0.32
180 0.37
181 0.39
182 0.36
183 0.34
184 0.33
185 0.26
186 0.26
187 0.26
188 0.23
189 0.23
190 0.28
191 0.31
192 0.31
193 0.31
194 0.28
195 0.25
196 0.22
197 0.19
198 0.19
199 0.24
200 0.26
201 0.32
202 0.37
203 0.41
204 0.47
205 0.48
206 0.47
207 0.47
208 0.55
209 0.57
210 0.63
211 0.7
212 0.73
213 0.78
214 0.83
215 0.84
216 0.83
217 0.8
218 0.78
219 0.74
220 0.7
221 0.69
222 0.63
223 0.58
224 0.51
225 0.46
226 0.39
227 0.34
228 0.27
229 0.23
230 0.22
231 0.23
232 0.29
233 0.35
234 0.4
235 0.46
236 0.53
237 0.59
238 0.62
239 0.62
240 0.57
241 0.53
242 0.52
243 0.45
244 0.38
245 0.31
246 0.25
247 0.2
248 0.18
249 0.13
250 0.09
251 0.08
252 0.09
253 0.1
254 0.11
255 0.14
256 0.19
257 0.2
258 0.21
259 0.24
260 0.27
261 0.27
262 0.26
263 0.23
264 0.19
265 0.16
266 0.15
267 0.12
268 0.09
269 0.08
270 0.06
271 0.06
272 0.05
273 0.05
274 0.05
275 0.06
276 0.06
277 0.07
278 0.07
279 0.08
280 0.09
281 0.09
282 0.1
283 0.11
284 0.13
285 0.15
286 0.18
287 0.2
288 0.25
289 0.28
290 0.33
291 0.36
292 0.34
293 0.36
294 0.35
295 0.32
296 0.27
297 0.23
298 0.17
299 0.13
300 0.13
301 0.09
302 0.07
303 0.07
304 0.07
305 0.07
306 0.06
307 0.06
308 0.07
309 0.07
310 0.06
311 0.06
312 0.05
313 0.05
314 0.07
315 0.08
316 0.07
317 0.08
318 0.11
319 0.15
320 0.15
321 0.17
322 0.21
323 0.23
324 0.3
325 0.34
326 0.36
327 0.34
328 0.41
329 0.47
330 0.48
331 0.47
332 0.43
333 0.46
334 0.49
335 0.57
336 0.62
337 0.65
338 0.71
339 0.79
340 0.84
341 0.88
342 0.9