Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5X2S2

Protein Details
Accession A0A2C5X2S2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-75IERQGTKGKEKRQSTKNRGAFCHydrophilic
NLS Segment(s)
PositionSequence
11-19RKRGRGRGR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
Amino Acid Sequences MDRIEERNEERKRGRGRGRGETSRQTDRQTDRHTDKQTSRQADKQTDRQTDRVIERQGTKGKEKRQSTKNRGAFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.69
4 0.72
5 0.76
6 0.75
7 0.73
8 0.72
9 0.68
10 0.68
11 0.63
12 0.55
13 0.53
14 0.5
15 0.52
16 0.48
17 0.5
18 0.49
19 0.55
20 0.55
21 0.54
22 0.54
23 0.55
24 0.56
25 0.54
26 0.51
27 0.48
28 0.5
29 0.53
30 0.53
31 0.53
32 0.55
33 0.57
34 0.57
35 0.54
36 0.51
37 0.49
38 0.48
39 0.46
40 0.41
41 0.37
42 0.37
43 0.41
44 0.44
45 0.43
46 0.48
47 0.49
48 0.54
49 0.6
50 0.66
51 0.69
52 0.73
53 0.8
54 0.81
55 0.84