Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XLF8

Protein Details
Accession A0A2C5XLF8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-216EVDREKKARGLKKKLKQARDLQEKEBasic
NLS Segment(s)
PositionSequence
196-208EKKARGLKKKLKQ
Subcellular Location(s) cyto_nucl 13.333, nucl 11.5, cyto_mito 8.331, cyto 8, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSPTQPPTTPTIAGIVVDDGGNRVIPESIRPDGTTRKAIRIRPGFRPAEDIERFRPRAAQGRAQHHARGPPGAEYTDRPTPPSRIASEINNTPPRTPSSSAASARASPSVRTPISSTPSTPTRSYSNQSAIPKSPAYLKMSWRRDDSSQKTATPSESLENVSLPVPVEKESKSIEDENVPSTEPEAPTIEVEVDREKKARGLKKKLKQARDLQEKESDGKTLLPEQLAKIGKIDELVLELKALGLSCDDDKGGVVTKEGKDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.15
3 0.12
4 0.11
5 0.1
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.08
12 0.08
13 0.12
14 0.17
15 0.19
16 0.2
17 0.22
18 0.25
19 0.31
20 0.35
21 0.41
22 0.38
23 0.45
24 0.5
25 0.53
26 0.6
27 0.62
28 0.63
29 0.62
30 0.69
31 0.63
32 0.57
33 0.58
34 0.51
35 0.5
36 0.49
37 0.44
38 0.42
39 0.47
40 0.48
41 0.42
42 0.43
43 0.37
44 0.43
45 0.44
46 0.47
47 0.46
48 0.52
49 0.58
50 0.57
51 0.57
52 0.5
53 0.49
54 0.42
55 0.37
56 0.3
57 0.26
58 0.25
59 0.23
60 0.21
61 0.2
62 0.23
63 0.27
64 0.27
65 0.27
66 0.28
67 0.3
68 0.32
69 0.34
70 0.31
71 0.28
72 0.3
73 0.3
74 0.32
75 0.33
76 0.36
77 0.38
78 0.37
79 0.33
80 0.33
81 0.33
82 0.33
83 0.32
84 0.27
85 0.27
86 0.33
87 0.33
88 0.34
89 0.32
90 0.28
91 0.26
92 0.27
93 0.22
94 0.16
95 0.17
96 0.2
97 0.19
98 0.18
99 0.2
100 0.2
101 0.24
102 0.24
103 0.23
104 0.21
105 0.25
106 0.27
107 0.26
108 0.24
109 0.24
110 0.26
111 0.29
112 0.28
113 0.28
114 0.3
115 0.32
116 0.32
117 0.29
118 0.28
119 0.25
120 0.22
121 0.22
122 0.2
123 0.22
124 0.22
125 0.28
126 0.35
127 0.4
128 0.42
129 0.41
130 0.41
131 0.41
132 0.48
133 0.47
134 0.45
135 0.42
136 0.4
137 0.4
138 0.38
139 0.35
140 0.27
141 0.22
142 0.16
143 0.15
144 0.15
145 0.13
146 0.12
147 0.12
148 0.11
149 0.1
150 0.08
151 0.08
152 0.07
153 0.09
154 0.11
155 0.11
156 0.13
157 0.14
158 0.15
159 0.18
160 0.19
161 0.18
162 0.2
163 0.21
164 0.2
165 0.2
166 0.18
167 0.15
168 0.15
169 0.16
170 0.13
171 0.13
172 0.13
173 0.13
174 0.13
175 0.13
176 0.13
177 0.1
178 0.11
179 0.15
180 0.16
181 0.17
182 0.18
183 0.18
184 0.22
185 0.3
186 0.38
187 0.43
188 0.51
189 0.6
190 0.68
191 0.78
192 0.83
193 0.83
194 0.83
195 0.83
196 0.82
197 0.83
198 0.78
199 0.71
200 0.69
201 0.63
202 0.58
203 0.49
204 0.39
205 0.28
206 0.26
207 0.24
208 0.21
209 0.21
210 0.19
211 0.2
212 0.2
213 0.26
214 0.27
215 0.25
216 0.22
217 0.21
218 0.19
219 0.19
220 0.18
221 0.1
222 0.11
223 0.12
224 0.11
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.06
231 0.06
232 0.09
233 0.09
234 0.11
235 0.11
236 0.1
237 0.11
238 0.12
239 0.16
240 0.13
241 0.15
242 0.2