Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MNU2

Protein Details
Accession B8MNU2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-47RDLRAAHGKEKQKRQKSKKQISIEHGBasic
NLS Segment(s)
PositionSequence
27-40AHGKEKQKRQKSKK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRMSKAYETTMNDLVLVQKENRDLRAAHGKEKQKRQKSKKQISIEHGITGEEAQALVQDQVEASQAVTTAPGEPELPASQAVFIVRTQPYWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.15
5 0.15
6 0.2
7 0.22
8 0.23
9 0.23
10 0.22
11 0.25
12 0.35
13 0.34
14 0.35
15 0.41
16 0.48
17 0.54
18 0.64
19 0.69
20 0.68
21 0.77
22 0.81
23 0.84
24 0.87
25 0.89
26 0.88
27 0.87
28 0.83
29 0.78
30 0.76
31 0.66
32 0.55
33 0.45
34 0.35
35 0.26
36 0.19
37 0.14
38 0.06
39 0.05
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.04
48 0.05
49 0.05
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.11
62 0.11
63 0.12
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.1
70 0.09
71 0.14
72 0.14