Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MGT7

Protein Details
Accession B8MGT7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-50ICTGNYRKPYPSSRRRRLRYRGDDPRKLFTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MRLRRLDGKAADLLCWLSLICTGNYRKPYPSSRRRRLRYRGDDPRKLFTTTVAPVTDYTSEIGGIAATGAFRTVATAVVEAEANICSFGERHIEKSTKLWADIRALPRTNPLNEAESHINSKAFLSTTYTDTRKRALPVKHTHDLYDRLKRKEAMALAQLRMGMTRLNSYPNKTGAAESDLCACKQCIEMRRGSLSFYLGGKARSDPEQWRPDIKAPLSWSINLNSLGVKNPSSMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.13
4 0.08
5 0.1
6 0.12
7 0.11
8 0.18
9 0.21
10 0.28
11 0.34
12 0.36
13 0.38
14 0.42
15 0.52
16 0.56
17 0.63
18 0.68
19 0.73
20 0.81
21 0.86
22 0.9
23 0.9
24 0.9
25 0.9
26 0.89
27 0.9
28 0.9
29 0.9
30 0.84
31 0.81
32 0.73
33 0.64
34 0.54
35 0.45
36 0.4
37 0.33
38 0.33
39 0.25
40 0.23
41 0.21
42 0.23
43 0.21
44 0.16
45 0.14
46 0.1
47 0.1
48 0.09
49 0.08
50 0.06
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.05
76 0.1
77 0.11
78 0.14
79 0.18
80 0.2
81 0.21
82 0.23
83 0.28
84 0.24
85 0.24
86 0.24
87 0.21
88 0.24
89 0.28
90 0.3
91 0.29
92 0.29
93 0.28
94 0.3
95 0.31
96 0.28
97 0.25
98 0.22
99 0.19
100 0.19
101 0.22
102 0.2
103 0.18
104 0.19
105 0.17
106 0.15
107 0.13
108 0.13
109 0.1
110 0.08
111 0.07
112 0.09
113 0.1
114 0.13
115 0.17
116 0.19
117 0.21
118 0.22
119 0.24
120 0.24
121 0.25
122 0.3
123 0.31
124 0.37
125 0.44
126 0.51
127 0.54
128 0.52
129 0.5
130 0.47
131 0.49
132 0.45
133 0.46
134 0.45
135 0.42
136 0.45
137 0.45
138 0.42
139 0.4
140 0.37
141 0.3
142 0.3
143 0.31
144 0.28
145 0.28
146 0.27
147 0.21
148 0.2
149 0.16
150 0.1
151 0.08
152 0.1
153 0.1
154 0.16
155 0.19
156 0.23
157 0.26
158 0.27
159 0.29
160 0.26
161 0.26
162 0.22
163 0.25
164 0.22
165 0.18
166 0.23
167 0.22
168 0.21
169 0.22
170 0.2
171 0.16
172 0.19
173 0.24
174 0.24
175 0.28
176 0.32
177 0.35
178 0.4
179 0.4
180 0.38
181 0.34
182 0.28
183 0.26
184 0.23
185 0.22
186 0.18
187 0.18
188 0.18
189 0.19
190 0.2
191 0.21
192 0.24
193 0.28
194 0.36
195 0.42
196 0.44
197 0.47
198 0.48
199 0.51
200 0.55
201 0.5
202 0.46
203 0.43
204 0.47
205 0.45
206 0.43
207 0.39
208 0.33
209 0.36
210 0.31
211 0.28
212 0.22
213 0.2
214 0.23
215 0.22
216 0.21
217 0.2