Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5X3Y1

Protein Details
Accession A0A2C5X3Y1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-58KSFRTKQKLAKAQKQNRPIPHydrophilic
64-85RTGNTIRYNAKRRNWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
74-80KRRNWRK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MGVHATLSTHTITVLTNISQVSYSSHLSNENTAKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRNWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.11
4 0.1
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.14
11 0.13
12 0.14
13 0.16
14 0.16
15 0.2
16 0.2
17 0.19
18 0.19
19 0.18
20 0.19
21 0.21
22 0.23
23 0.21
24 0.24
25 0.28
26 0.32
27 0.4
28 0.48
29 0.53
30 0.55
31 0.6
32 0.64
33 0.69
34 0.72
35 0.73
36 0.75
37 0.76
38 0.79
39 0.8
40 0.78
41 0.76
42 0.73
43 0.71
44 0.66
45 0.65
46 0.66
47 0.6
48 0.59
49 0.55
50 0.52
51 0.52
52 0.53
53 0.53
54 0.48
55 0.5
56 0.51
57 0.57
58 0.63
59 0.64
60 0.66
61 0.69
62 0.74
63 0.8
64 0.83
65 0.84