Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5X1Y8

Protein Details
Accession A0A2C5X1Y8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-44EAQEKKKSPKGRARKRLLYTRRFBasic
NLS Segment(s)
PositionSequence
19-37PKVEAQEKKKSPKGRARKR
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEAQEKKKSPKGRARKRLLYTRRFVNVTLTNGKRKMNPSPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.45
5 0.46
6 0.52
7 0.51
8 0.56
9 0.56
10 0.57
11 0.59
12 0.61
13 0.64
14 0.64
15 0.66
16 0.65
17 0.69
18 0.71
19 0.72
20 0.77
21 0.78
22 0.81
23 0.81
24 0.83
25 0.82
26 0.79
27 0.73
28 0.7
29 0.66
30 0.58
31 0.52
32 0.48
33 0.44
34 0.41
35 0.45
36 0.43
37 0.45
38 0.47
39 0.49
40 0.47
41 0.47
42 0.52