Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5WUM2

Protein Details
Accession A0A2C5WUM2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-72MEKEIKKKTSLSRKKQQSQVQNHIHNPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MGMRSRDGHDVDDIYARTEEQFHNTTQTQRSLILATHKTSPIQAPMEKEIKKKTSLSRKKQQSQVQNHIHNPKTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.14
5 0.16
6 0.15
7 0.16
8 0.18
9 0.16
10 0.21
11 0.22
12 0.25
13 0.26
14 0.27
15 0.23
16 0.22
17 0.22
18 0.18
19 0.17
20 0.2
21 0.19
22 0.18
23 0.19
24 0.19
25 0.18
26 0.18
27 0.18
28 0.16
29 0.17
30 0.17
31 0.18
32 0.22
33 0.29
34 0.31
35 0.34
36 0.36
37 0.36
38 0.38
39 0.4
40 0.45
41 0.5
42 0.58
43 0.64
44 0.68
45 0.76
46 0.81
47 0.86
48 0.85
49 0.84
50 0.84
51 0.84
52 0.84
53 0.81
54 0.8
55 0.8