Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5XK91

Protein Details
Accession A0A2C5XK91   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-29GMTGVRCLKRRTKKWWEIKEITLHydrophilic
NLS Segment(s)
PositionSequence
67-68RK
Subcellular Location(s) mito 14, mito_nucl 12.333, nucl 9.5, cyto_mito 9.333
Family & Domain DBs
Amino Acid Sequences MNRINKGMTGVRCLKRRTKKWWEIKEITLAEANQVIAEGGFSTDNVSQSASPLRIHINGHSEEKARRKEAVRLKRQATRESGLSRNTQGAAPSVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.7
4 0.72
5 0.74
6 0.78
7 0.82
8 0.87
9 0.87
10 0.82
11 0.76
12 0.74
13 0.63
14 0.54
15 0.45
16 0.35
17 0.25
18 0.21
19 0.18
20 0.09
21 0.08
22 0.07
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.05
30 0.06
31 0.07
32 0.07
33 0.08
34 0.07
35 0.08
36 0.1
37 0.09
38 0.09
39 0.09
40 0.11
41 0.12
42 0.13
43 0.14
44 0.17
45 0.18
46 0.21
47 0.21
48 0.22
49 0.25
50 0.32
51 0.36
52 0.33
53 0.36
54 0.36
55 0.43
56 0.51
57 0.57
58 0.6
59 0.63
60 0.66
61 0.68
62 0.71
63 0.68
64 0.63
65 0.57
66 0.53
67 0.5
68 0.5
69 0.46
70 0.45
71 0.41
72 0.38
73 0.35
74 0.3
75 0.26