Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5WV05

Protein Details
Accession A0A2C5WV05    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
208-229TPDGQRLRPHSRPPRRRPSLSPBasic
355-378GRERERKSSRPLVQRPVRLRRRADBasic
NLS Segment(s)
PositionSequence
216-224PHSRPPRRR
358-366RERKSSRPL
368-374QRPVRLR
Subcellular Location(s) mito 16, nucl 6, extr 4
Family & Domain DBs
Amino Acid Sequences MNPSDRPRLRPRLRLPATPVPVAAPASDPSSLSLGAFLSTGSTTGPAPTASPATSPTASASATAAPSTTPASTFVATTPVATLPKLHTTCARRSISSTEHRQNSPHTVSIPAVHVGSLHGLSGPNVASRRLQPRRSSSSLGSAHLSSHPSHWQLSQQQQFMQSLDTSPIATRTATTNATAAAAPTTAPATAAGVPLFGGVVDFGFSKTPDGQRLRPHSRPPRRRPSLSPAPLHLVPGHAGGTPAPPSTLGRFASCPSSPPSSRSPSPRQPSVSMLVASKTYKHKPTSASAGTFTSTSTSKSTATATATGLDAGTTATTTLSGMRAAGDFHVDLLDDVEEMCQVMVSFGSVQDRLGRERERKSSRPLVQRPVRLRRRADGGVYTSPAAATAAASTGAVRDQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.74
5 0.65
6 0.56
7 0.47
8 0.43
9 0.36
10 0.28
11 0.2
12 0.16
13 0.17
14 0.17
15 0.16
16 0.15
17 0.16
18 0.16
19 0.13
20 0.13
21 0.1
22 0.1
23 0.1
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.09
33 0.08
34 0.09
35 0.11
36 0.14
37 0.13
38 0.14
39 0.15
40 0.19
41 0.19
42 0.19
43 0.19
44 0.18
45 0.17
46 0.17
47 0.16
48 0.13
49 0.13
50 0.13
51 0.11
52 0.09
53 0.1
54 0.11
55 0.11
56 0.09
57 0.11
58 0.13
59 0.14
60 0.14
61 0.14
62 0.15
63 0.15
64 0.14
65 0.13
66 0.13
67 0.13
68 0.13
69 0.15
70 0.14
71 0.23
72 0.24
73 0.24
74 0.29
75 0.34
76 0.4
77 0.48
78 0.47
79 0.39
80 0.42
81 0.46
82 0.46
83 0.49
84 0.52
85 0.51
86 0.54
87 0.54
88 0.53
89 0.52
90 0.52
91 0.47
92 0.4
93 0.33
94 0.29
95 0.29
96 0.28
97 0.26
98 0.19
99 0.16
100 0.13
101 0.12
102 0.1
103 0.11
104 0.09
105 0.07
106 0.06
107 0.07
108 0.07
109 0.08
110 0.08
111 0.1
112 0.1
113 0.11
114 0.13
115 0.18
116 0.28
117 0.35
118 0.41
119 0.45
120 0.53
121 0.6
122 0.63
123 0.61
124 0.53
125 0.53
126 0.49
127 0.44
128 0.38
129 0.3
130 0.26
131 0.24
132 0.24
133 0.15
134 0.16
135 0.17
136 0.17
137 0.18
138 0.18
139 0.21
140 0.25
141 0.33
142 0.37
143 0.35
144 0.35
145 0.36
146 0.36
147 0.31
148 0.26
149 0.18
150 0.12
151 0.12
152 0.11
153 0.09
154 0.08
155 0.09
156 0.09
157 0.08
158 0.08
159 0.09
160 0.12
161 0.12
162 0.12
163 0.12
164 0.11
165 0.12
166 0.11
167 0.09
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.05
177 0.06
178 0.06
179 0.06
180 0.05
181 0.05
182 0.05
183 0.05
184 0.03
185 0.03
186 0.02
187 0.02
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.06
194 0.08
195 0.1
196 0.16
197 0.2
198 0.23
199 0.31
200 0.4
201 0.46
202 0.48
203 0.57
204 0.61
205 0.68
206 0.75
207 0.78
208 0.8
209 0.81
210 0.81
211 0.78
212 0.76
213 0.76
214 0.72
215 0.64
216 0.55
217 0.52
218 0.47
219 0.42
220 0.33
221 0.23
222 0.16
223 0.15
224 0.13
225 0.08
226 0.08
227 0.07
228 0.08
229 0.09
230 0.08
231 0.07
232 0.07
233 0.08
234 0.1
235 0.14
236 0.14
237 0.15
238 0.16
239 0.17
240 0.21
241 0.19
242 0.2
243 0.19
244 0.24
245 0.24
246 0.26
247 0.31
248 0.33
249 0.37
250 0.43
251 0.49
252 0.52
253 0.58
254 0.6
255 0.59
256 0.54
257 0.54
258 0.5
259 0.43
260 0.35
261 0.29
262 0.23
263 0.22
264 0.19
265 0.2
266 0.22
267 0.26
268 0.31
269 0.33
270 0.37
271 0.39
272 0.43
273 0.48
274 0.47
275 0.43
276 0.38
277 0.36
278 0.33
279 0.29
280 0.24
281 0.17
282 0.13
283 0.13
284 0.13
285 0.14
286 0.14
287 0.15
288 0.16
289 0.17
290 0.18
291 0.18
292 0.17
293 0.16
294 0.15
295 0.14
296 0.12
297 0.1
298 0.07
299 0.06
300 0.05
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.06
307 0.06
308 0.06
309 0.06
310 0.07
311 0.08
312 0.08
313 0.08
314 0.1
315 0.09
316 0.09
317 0.09
318 0.08
319 0.08
320 0.08
321 0.08
322 0.06
323 0.06
324 0.06
325 0.05
326 0.05
327 0.05
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.06
334 0.07
335 0.1
336 0.1
337 0.11
338 0.16
339 0.18
340 0.2
341 0.26
342 0.33
343 0.38
344 0.45
345 0.55
346 0.59
347 0.62
348 0.68
349 0.72
350 0.74
351 0.77
352 0.78
353 0.79
354 0.79
355 0.83
356 0.84
357 0.84
358 0.85
359 0.83
360 0.8
361 0.76
362 0.75
363 0.7
364 0.65
365 0.61
366 0.57
367 0.53
368 0.5
369 0.44
370 0.36
371 0.31
372 0.26
373 0.19
374 0.13
375 0.09
376 0.07
377 0.07
378 0.07
379 0.07
380 0.07
381 0.07
382 0.08