Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZQV4

Protein Details
Accession A0A2C5ZQV4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-95ASPGRRQQSRWARRQPRADRRHPFPFAHydrophilic
NLS Segment(s)
PositionSequence
54-89RRPDRSSRGPDASPPASPGRRQQSRWARRQPRADRR
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MMPRLVRLPHSLRSSRCCPSLEADSVEAALHLVVDVDDPLPGCLLYRAVPAAPRRPDRSSRGPDASPPASPGRRQQSRWARRQPRADRRHPFPFADARDMAGCLSLARAACTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.54
4 0.48
5 0.42
6 0.41
7 0.42
8 0.38
9 0.34
10 0.3
11 0.26
12 0.25
13 0.23
14 0.17
15 0.11
16 0.07
17 0.05
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.11
37 0.14
38 0.2
39 0.25
40 0.29
41 0.33
42 0.37
43 0.41
44 0.44
45 0.51
46 0.49
47 0.49
48 0.49
49 0.45
50 0.43
51 0.44
52 0.39
53 0.3
54 0.27
55 0.26
56 0.24
57 0.25
58 0.3
59 0.34
60 0.39
61 0.41
62 0.49
63 0.55
64 0.63
65 0.71
66 0.75
67 0.75
68 0.77
69 0.86
70 0.86
71 0.86
72 0.86
73 0.87
74 0.84
75 0.82
76 0.83
77 0.77
78 0.68
79 0.62
80 0.61
81 0.55
82 0.52
83 0.45
84 0.37
85 0.34
86 0.32
87 0.27
88 0.19
89 0.15
90 0.09
91 0.09
92 0.1
93 0.09