Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C6AGR2

Protein Details
Accession A0A2C6AGR2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-123RTVMQSLPAARRRRRRRRRRHGSBasic
NLS Segment(s)
PositionSequence
110-123ARRRRRRRRRRHGS
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MQRPPSLAKSGSCGLAVMCCPPMADLRQMTTTWHAKARFDLGRRPTTRASSAPPTPLLRADWTAGPSGPLFPQDPTTSREIEAAAAEPAQNASRTLPLRCRTVMQSLPAARRRRRRRRRRHGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.13
5 0.12
6 0.1
7 0.1
8 0.11
9 0.14
10 0.14
11 0.18
12 0.17
13 0.2
14 0.22
15 0.22
16 0.23
17 0.26
18 0.27
19 0.25
20 0.29
21 0.27
22 0.26
23 0.28
24 0.32
25 0.32
26 0.31
27 0.36
28 0.37
29 0.45
30 0.46
31 0.48
32 0.45
33 0.43
34 0.43
35 0.38
36 0.37
37 0.33
38 0.33
39 0.31
40 0.3
41 0.28
42 0.26
43 0.25
44 0.21
45 0.16
46 0.16
47 0.15
48 0.13
49 0.12
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.11
60 0.12
61 0.14
62 0.16
63 0.18
64 0.18
65 0.17
66 0.18
67 0.15
68 0.14
69 0.13
70 0.11
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.14
81 0.16
82 0.19
83 0.26
84 0.29
85 0.33
86 0.34
87 0.36
88 0.34
89 0.39
90 0.4
91 0.35
92 0.4
93 0.41
94 0.48
95 0.52
96 0.58
97 0.59
98 0.66
99 0.74
100 0.78
101 0.84
102 0.87
103 0.91