Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C6ALF7

Protein Details
Accession A0A2C6ALF7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, mito 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKATSEKLYKDVQSYRLVTIATLVDRMKINGSLARQCIADLEEKGMIKAVVTHSKMKIYTRAVGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.16
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.18
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.23
33 0.22
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.14
48 0.16
49 0.16
50 0.17
51 0.16
52 0.16
53 0.15
54 0.14
55 0.15
56 0.12
57 0.13
58 0.15
59 0.15
60 0.15
61 0.15
62 0.14
63 0.1
64 0.13
65 0.15
66 0.2
67 0.23
68 0.29
69 0.3
70 0.34
71 0.37
72 0.37
73 0.4
74 0.37
75 0.39