Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Z108

Protein Details
Accession A0A2C5Z108    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-67QLARKHWLKPGKRTTRPKVKNEVLHydrophilic
NLS Segment(s)
PositionSequence
52-60KPGKRTTRP
Subcellular Location(s) nucl 21.5, mito_nucl 14, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032174  Aquarius_N  
Pfam View protein in Pfam  
PF16399  Aquarius_N  
Amino Acid Sequences MPNAKRLKSSGFTRPRQAKETGSQTEVGRPTPAEVEEKEHQFVQLARKHWLKPGKRTTRPKVKNEVLKQSIWDVLDKEGFQYKSLLLLESLQALESYLWPSYSEQSSNYHVLLMALIANAKRREHLDTWNIFEDRPDDFSSMFRQLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.67
4 0.65
5 0.6
6 0.58
7 0.61
8 0.55
9 0.48
10 0.46
11 0.42
12 0.44
13 0.4
14 0.33
15 0.25
16 0.21
17 0.2
18 0.19
19 0.2
20 0.17
21 0.16
22 0.22
23 0.25
24 0.27
25 0.28
26 0.26
27 0.24
28 0.22
29 0.24
30 0.25
31 0.26
32 0.25
33 0.29
34 0.33
35 0.34
36 0.39
37 0.45
38 0.44
39 0.49
40 0.58
41 0.63
42 0.69
43 0.78
44 0.81
45 0.83
46 0.86
47 0.82
48 0.81
49 0.78
50 0.77
51 0.73
52 0.73
53 0.64
54 0.56
55 0.5
56 0.41
57 0.36
58 0.27
59 0.22
60 0.13
61 0.11
62 0.12
63 0.11
64 0.11
65 0.13
66 0.13
67 0.13
68 0.13
69 0.12
70 0.13
71 0.14
72 0.13
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.06
85 0.06
86 0.07
87 0.09
88 0.11
89 0.13
90 0.13
91 0.13
92 0.17
93 0.21
94 0.22
95 0.21
96 0.18
97 0.16
98 0.15
99 0.14
100 0.1
101 0.07
102 0.05
103 0.06
104 0.07
105 0.12
106 0.14
107 0.15
108 0.17
109 0.19
110 0.26
111 0.27
112 0.35
113 0.39
114 0.41
115 0.46
116 0.5
117 0.48
118 0.41
119 0.4
120 0.33
121 0.27
122 0.26
123 0.23
124 0.18
125 0.18
126 0.21
127 0.25